(data stored in ACNUC7421 zone)

EMBL: CP000031.PE305

CP000031.PE305       Location/Qualifiers
FT   CDS_pept        326914..328560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0316"
FT                   /product="electrotransfer ubiquinone oxidoreductase family
FT                   protein"
FT                   /note="identified by similarity to SP:Q16134; match to
FT                   protein family HMM PF05187"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93634"
FT                   /db_xref="GOA:Q5LXA0"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXA0"
FT                   /protein_id="AAV93634.1"
FT                   /translation="MAEIEREAMEYDVVIVGAGPAGLSAAIRLKQLDADLNVVVLEKGS
FT                   EVGAHILSGAVLDPCGLDALIPDWKEKGAPLNVPVKDDNFYMLGEAGQIRIPNFPMPPL
FT                   MNNHGNYIVSMANVCRWMAEQAEELGVEIFPGMSCSELVYGDNGEVKGVVAGVFGLEAD
FT                   GSYGPNTEPGMELHGKYVFLSEGVRGSLAKEVIAKYDLQKGKEPQKFGVGMKEIWEIDP
FT                   AKHREGSVTHTMGWPLGGNAGGGSFIYHLDNNQVYVGFVVHLNYKNPHLFPYMEFQRFK
FT                   HHPMVAELLKGGKRVAYGARAITEGGYQSMPKMVAPGVALLGCSVGMVNVPRIKGNHNA
FT                   MLSGKAAAEAAHAAIKAGRQSDELSDYETEVRSGPIGKDLKKVRNVKPMWSKWGLAASL
FT                   ALGGLDMWTNTLGFSLFGTLGHGKTDAAATEDASKHKPIDYPKPDGVLSFDRLTNVSFA
FT                   ATNHEESQPCHLRLTDPDLPVKVNLPKYDEPAQRYCPAGVYEVVEDEGGPRFVVNFQNC
FT                   VHCKTCDIKDPSQNITWVTPQGGDGPNYPNM"
     atggccgaga ttgaacgcga agcgatggaa tatgacgtgg tgatcgtcgg ggcgggtccg        60
     gcgggcctgt cggcggccat tcgtctcaag cagctcgatg ccgacctgaa tgtcgtcgtg       120
     ctggaaaagg gctcggaggt gggcgcgcat atcctgtcgg gcgcggtgct ggatccctgt       180
     ggtctggatg cgctgatccc cgactggaag gagaagggcg cgccgctgaa cgtgccggtc       240
     aaggacgaca acttctatat gctgggcgag gccgggcaga tccgcatccc caactttccg       300
     atgccgccgc tgatgaacaa ccacggcaac tacatcgttt cgatggccaa tgtctgccgc       360
     tggatggccg aacaggccga ggaactgggt gtcgagattt tccccggcat gtcctgctcg       420
     gaactggtct atggcgacaa tggcgaggtc aagggcgtgg ttgccggtgt cttcggcctc       480
     gaggcggacg ggtcctatgg ccccaacacc gaaccgggga tggagctgca cggcaaatat       540
     gtcttcctgt ccgaaggcgt gcgcgggtcg ctggccaagg aagtcatcgc caaatacgac       600
     ctgcaaaaag gcaaggagcc gcagaaattc ggcgtcggca tgaaagagat ctgggagatc       660
     gacccggcca agcatcgcga aggctcggtc acccacacga tgggctggcc gctgggcggc       720
     aatgcgggcg gcgggtcgtt catctaccac ctggacaaca accaggtcta tgtcggtttc       780
     gtggtgcacc tgaactacaa gaacccgcac ctgttcccct atatggagtt ccagcggttc       840
     aagcatcacc cgatggtggc cgaactgctg aaaggcggca agcgcgtcgc ctatggcgcc       900
     cgcgccatca ccgagggcgg ataccagtcg atgcccaaga tggtagcgcc cggcgtggcg       960
     ctgctgggct gttcggtcgg catggtcaac gtgccgcgca tcaagggcaa ccataacgcg      1020
     atgctgtcgg gcaaggccgc ggccgaggcc gcccatgccg ccatcaaggc gggccgccag      1080
     tcggacgagc tgagcgatta cgagaccgaa gtgcgcagcg gcccgatcgg caaggacctg      1140
     aaaaaggtcc gcaacgtcaa gccgatgtgg tcgaaatggg gccttgccgc cagcctggcg      1200
     ctgggcgggc tggacatgtg gaccaatacg ctgggctttt cgctgttcgg caccctgggc      1260
     catggcaaga ccgacgccgc cgcgaccgag gatgccagca aacacaagcc catcgactat      1320
     cccaagcccg atggcgtgct atccttcgac cggctcacca acgtgtcttt tgccgccacc      1380
     aaccacgagg aaagccagcc ctgccacctg cggctgaccg accccgacct gccggtcaag      1440
     gtgaacctgc ccaaatatga cgagccggca cagcgctatt gcccggctgg cgtctacgag      1500
     gtggtcgagg atgagggcgg cccgcgcttt gtcgtcaact tccagaactg cgtgcactgc      1560
     aagacctgcg atatcaagga tcccagccag aacatcacct gggtcacccc gcagggtggc      1620
     gacggtccga actatcccaa catgtga                                          1647
//

If you have problems or comments...

PBIL Back to PBIL home page