(data stored in ACNUC9435 zone)

EMBL: CP000031.PE31

CP000031.PE31        Location/Qualifiers
FT   CDS_pept        31568..32086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0031"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="identified by match to protein family HMM PF03734"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93362"
FT                   /db_xref="GOA:Q5LWI9"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWI9"
FT                   /protein_id="AAV93362.2"
FT                   /translation="MDRRHFGLGAAAALGLSACGSQDSKFRRYYGPAVTSIVINKGARK
FT                   MYLLNNEKVLKEYKVELGFAPAGHKQFEGDGKTPEGTYLIDRRNPNSAFHLSLGISYPN
FT                   SRDVAYAQAMGKKPGGEIFIHGEPNGLRDRKKAKKQPDWTAGCIAVKNDEIEEIYAMVR
FT                   DGTVITLRA"
     atggatcgtc ggcattttgg tcttggcgcg gccgccgcgc ttggcctgtc ggcctgcggc        60
     agccaggaca gcaagttccg ccgctattac gggcctgcgg tcacctcgat cgtgatcaac       120
     aagggcgcgc gtaagatgta cctgttgaac aacgaaaagg tgctgaagga gtacaaggtc       180
     gaactgggtt ttgccccggc agggcacaaa cagttcgaag gcgacggcaa gacgcccgag       240
     ggcacctatc tgatcgaccg gcgcaatccc aacagcgcat tccatctgtc gctgggcatc       300
     tcttatccca actcgcgcga tgtggcctat gcccaggcga tgggcaagaa gccgggcggc       360
     gaaatcttca ttcatggcga gcccaatggg ttgcgcgacc gcaagaaggc aaagaaacag       420
     ccggattgga ccgctggctg catcgccgtc aagaatgacg agatcgaaga gatctatgcc       480
     atggtgcgcg atgggacggt gatcaccctg cgcgcctga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page