(data stored in ACNUC7421 zone)

EMBL: CP000031.PE310

CP000031.PE310       Location/Qualifiers
FT   CDS_pept        332618..333391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0321"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAD24416.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93639"
FT                   /db_xref="GOA:Q5LXB3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXB3"
FT                   /protein_id="AAV93639.1"
FT                   /translation="MTAFAESELSCDAFLGGHLRLFQPRDGYRAGVDPVFLAASVAAQT
FT                   GQSVLELGCGAGAAILSLGARVPDLALTGVELQPGYADLARRNAAANDIALDVVEGDIA
FT                   ALPQALRQQSFDHVIANPPYYLAGSHSPASDAGRATALGERTPLALWIDAAARRLTHRG
FT                   YLHMIAKADRLPDMLAACDDRLGSLEVLPLMPRQGRAAELVILRARKGGRAPFRLQSGL
FT                   FLHQGSRHPGDRDHYLPEIAKVLRQPAPLPWPGAG"
     atgaccgcct ttgccgagag cgagctgagc tgtgacgcct ttctgggcgg tcacctgcgg        60
     ctgtttcagc cgcgagacgg atatcgggcc ggggtcgatc cggtgtttct ggccgccagc       120
     gtcgccgcac agaccgggca atcggtgctg gaactgggct gtggcgccgg tgcggcgatc       180
     ctgtctctgg gcgcccgggt gcccgatctg gcgctgaccg gggtcgagtt gcagccgggc       240
     tatgccgatc tggcgcggcg caacgcagca gcgaacgata tcgcgctcga cgtggtcgaa       300
     ggcgatatcg ccgcgctgcc gcaggcactg cgccagcaga gctttgacca tgtcatcgcc       360
     aacccgccct attatctggc tggcagccac agcccggcca gcgatgcggg ccgggccacc       420
     gccttgggag agcggacgcc ccttgcgctc tggatcgatg cggcggcgcg gcggctgacc       480
     catcgcggct atctgcacat gatcgccaag gccgaccgct tgccggatat gctggcggcc       540
     tgcgatgacc ggctgggctc gcttgaggtg ttgccgctga tgccgcggca ggggcgcgcc       600
     gccgagctgg tgattctgcg tgcccgcaag ggcgggcggg cgccatttcg cctgcagtcc       660
     gggctgttcc tgcatcaggg cagccggcat ccaggcgacc gcgaccacta cctgcctgaa       720
     atcgcgaagg tcctgcgcca acccgccccg ctgccctggc ccggcgccgg ataa             774
//

If you have problems or comments...

PBIL Back to PBIL home page