(data stored in ACNUC9435 zone)

EMBL: CP000031.PE311

CP000031.PE311       Location/Qualifiers
FT   CDS_pept        333505..333669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0322"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:AE3289; match to
FT                   protein family HMM PF04325"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93640"
FT                   /db_xref="GOA:Q5LXB2"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXB2"
FT                   /protein_id="AAV93640.1"
FT                   /translation="MSVSAHLTELKKKHANLSLEVEQAQRSPGTDDLQISQLKKQKLKL
FT                   KEEIERLSV"
     atgagtgtga gcgcgcattt gaccgaactg aagaaaaagc acgcaaatct cagtctcgaa        60
     gttgaacaag cccagcgttc gccaggtact gacgaccttc agatcagcca gctcaagaag       120
     cagaagctga aactcaagga agaaatcgag cggctgtccg tctaa                       165
//

If you have problems or comments...

PBIL Back to PBIL home page