(data stored in ACNUC7421 zone)

EMBL: CP000031.PE312

CP000031.PE312       Location/Qualifiers
FT   CDS_pept        complement(333666..334532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0323"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93641"
FT                   /db_xref="GOA:Q5LXB1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXB1"
FT                   /protein_id="AAV93641.1"
FT                   /translation="MTRSRATAIGFVAVLLWALLALLTVGSAPVPPLLLNALCFTVGGL
FT                   LGLVWVLATGGLAQLRGVRWPVYAFGTLGLFGYHALYFSALRLAPAAEAGLIAYLWPLL
FT                   IVLFSGLLPGERLRSGHLLGAALAFAGAGLIITGGGGPGFQAQYLPGYGLALLCALTWS
FT                   GYSVLSRRMGDAPTSSVAVFCLATAVASWGLHFMVEETVWPQDMLGWGATLALGLGPVG
FT                   LAFYVWDIGVKRGDIQLLGTSSYAAPLLSTLVLVISGIAAPSWVLALSALLITGGALLA
FT                   ARASLSA"
     atgacccgtt cccgcgccac agccatcgga tttgtcgccg tccttctatg ggcgctgctt        60
     gcactgctga ccgtcggatc agcgccggtg ccgccgctct tgctgaatgc gctctgcttc       120
     accgtaggcg ggctgctggg gctggtctgg gtgctggcga ccggtggcct ggcccagctg       180
     cgcggtgtcc gctggccggt ctatgccttt ggcacgctgg gactgtttgg ctatcacgcg       240
     ctctatttct cggcgctcag gctggcgccc gcggccgagg cggggttgat cgcctatctc       300
     tggccgctgt tgatcgtgct gttctcgggc ctcctgccgg gtgagcgtct gcggagcggc       360
     catctgctgg gggcagcgct cgcctttgcc ggggccgggc tgatcatcac cggcgggggc       420
     ggtcccgggt ttcaggcgca atatctgccg ggctacggcc tggcactgct ctgtgcgctg       480
     acctggtcgg gctattcggt cctgtcgcgg cggatgggcg atgcgcccac cagttcggtc       540
     gccgtgttct gcctggccac ggcggtggcg tcatggggcc tgcatttcat ggttgaagaa       600
     acggtctggc cgcaggacat gctgggctgg ggcgccacgc tggcactggg tctgggcccg       660
     gtgggcctgg ccttttacgt ctgggatatc ggggtgaaac gtggagatat ccagctgctg       720
     ggaaccagtt cctatgcggc tccgctactg tccacgctgg ttcttgtgat cagcggcatc       780
     gctgcaccca gctgggtact tgcgctctcg gccctgctga tcactggcgg cgcgctgctg       840
     gcagcgcgcg ccagcttgtc ggcttag                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page