(data stored in ACNUC7421 zone)

EMBL: CP000031.PE317

CP000031.PE317       Location/Qualifiers
FT   CDS_pept        complement(339136..340068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0328"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAB48523.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93646"
FT                   /db_xref="GOA:Q5LXA6"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXA6"
FT                   /protein_id="AAV93646.1"
FT                   /translation="MIETLSFPDPTQLAVPFFIAAILIEFLWIAMKKRGGRYETRDAVT
FT                   SLIMGAGSVAEGILLGFIAWAFFMLLWRVTPLDMGTSIWAVLICFVLDDLRYYWVHRFG
FT                   HRVRWVWASHVNHHSSQHYNLTTALRQTWTGTFTFMMVVKAPMVLLGFHPALVLFCGGL
FT                   NLIYQFWIHTEAIDKLPRWFEAVMNTPSHHRVHHGRNPRYLDCNYAGVFIIWDKMFGTF
FT                   VPEQEDEKVDYGLVHNLGTFNPLRVAFHEWLGIWRDVTQPGLSLRQRLAYAFAPPGYSH
FT                   DGSRETSEGIKARYLATHPEQRGTPGFEG"
     atgatcgaaa cgctcagctt tcccgatccc acacaactgg ctgtgccctt cttcatcgcc        60
     gccatcctga tcgaattcct gtggatcgcc atgaaaaagc gcggcgggcg ctatgaaacc       120
     cgcgatgccg tcacctcgct gatcatgggg gccgggtcgg tggccgaggg cattctgctg       180
     gggttcatcg cctgggcgtt cttcatgttg ctgtggcgag tcacgccgct ggacatgggc       240
     acctcgatct gggcggtgct gatctgtttc gtgctggacg acctgcgcta ttactgggtg       300
     caccggttcg gtcatcgggt gcgctgggtc tgggccagcc atgtgaacca tcattccagc       360
     cagcattaca acctgaccac cgcactcaga cagacctgga ccggcacgtt caccttcatg       420
     atggtggtca aggcgccgat ggtcctgctt gggttccatc cggcgctggt gctgttctgc       480
     ggcgggctga acctgatcta tcagttctgg atccacaccg aggcgatcga caaactgccc       540
     cgctggttcg aggcagtgat gaacacaccc agccaccacc gcgtgcatca tggtcgcaat       600
     ccccgctatc tggactgcaa ttatgcgggc gttttcatca tctgggacaa gatgttcggc       660
     actttcgtgc ccgagcaaga ggatgaaaag gtcgactatg gcctggttca caacctcggc       720
     accttcaacc cgctgcgggt ggcgtttcac gaatggctgg ggatctggcg cgatgtcacc       780
     caaccggggc tcagcctgcg ccagcgcctg gcctatgcct ttgccccgcc gggttacagt       840
     catgatggca gccgcgagac ctcggagggg atcaaggccc gctatctggc cacccacccc       900
     gaacagcggg gcacaccggg tttcgaaggc taa                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page