(data stored in ACNUC9435 zone)

EMBL: CP000031.PE318

CP000031.PE318       Location/Qualifiers
FT   CDS_pept        complement(340065..340484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0329"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93647"
FT                   /db_xref="GOA:Q5LXC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXC3"
FT                   /protein_id="AAV93647.1"
FT                   /translation="MSFTLRCREGPMPLEILLILVIGGISTIAVILHLSGRSKRADLTL
FT                   ETARAAWLRHFPQDTVHDILLARDGHAALVETETGPGLLWALGADTVGRRLQDYALSET
FT                   ADGLAIRFHDFTAPRVTLTLAPDETPIWQQRLARA"
     atgagcttca ctctgcgttg cagggagggg ccaatgccac ttgaaatcct gctgatcctg        60
     gtgatcggag gcatctcgac catcgcggtt atcctgcatc tgagcgggcg gtcgaaacgt       120
     gccgatctga ctctcgagac cgcgcgtgcc gcgtggttgc ggcattttcc ccaggacacg       180
     gtgcacgata tcctgctggc ccgcgatggc cacgccgccc tggtcgaaac cgagaccggc       240
     cccggcctgc tttgggcatt gggcgccgac acggttggcc gacggctgca agactacgcg       300
     ctgagcgaga ctgcggatgg attggccata cggtttcacg atttcaccgc gccccgcgtc       360
     accctgacac tcgcccccga cgaaacgccg atctggcaac aaagactggc ccgcgcatga       420
//

If you have problems or comments...

PBIL Back to PBIL home page