(data stored in ACNUC7421 zone)

EMBL: CP000031.PE32

CP000031.PE32        Location/Qualifiers
FT   CDS_pept        32458..33366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0033"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93364"
FT                   /db_xref="GOA:Q5LWI7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWI7"
FT                   /protein_id="AAV93364.1"
FT                   /translation="MRLPPLNALRAFEAAARHNGYIAAAEELCVTRGAVSRHIKLLEDH
FT                   LGVTLFHRNHRGVELTAAGRQLLPVLTETFARIAREAEQISAMTRDVRIICPPALSIRW
FT                   LFPRLEEFQAAHPDIRVRLTTEFYGAKGFDDTEHDLGVSVEHVSGRGAGIASMPLFPMV
FT                   LSPACSPALLRQRPLSAPADLARMTLLHESPQRRDWAHWLSSFGVRGVDAGSGPTFPNL
FT                   DMAARAATMGAGVVMADLALCQEELRAGTLVLPFPEMTCTTPQGGYVLLGARARWDEPH
FT                   LRAFRDWAASSSADLVACMGA"
     atgcgcttgc cgccgctgaa cgccctgcgc gctttcgaag ccgccgcacg ccataacggc        60
     tatatcgcgg ccgccgaaga gctctgcgtg acccgtggcg ctgtcagccg tcatatcaag       120
     ctgctcgagg atcatctggg cgttaccctg tttcaccgaa atcaccgcgg ggtcgagctg       180
     accgcggcgg ggcggcagtt gctgcccgtg ctgaccgaga cctttgcccg gatcgcgcgc       240
     gaggccgaac agatctcggc catgacgcgg gatgtgcgga tcatctgccc gccggcgctg       300
     tccattcgct ggctgttccc gcgtctcgag gagtttcagg ccgcgcatcc tgacatccgg       360
     gtgcggctga ccaccgagtt ctatggcgcc aaggggtttg acgataccga gcatgatctg       420
     ggtgtttcgg tcgaacatgt ttccggccga ggcgccggaa tcgccagcat gccgctgttt       480
     ccgatggttc tgtcaccggc ctgttcgccg gcgctgctgc gccagcgacc gctaagcgct       540
     ccggccgatc tggcgcggat gacgctgctt catgaatccc ctcagcgcag ggactgggcg       600
     cattggttgt ccagctttgg cgtgcgcggt gttgatgcgg gcagcgggcc gacctttccg       660
     aacctggata tggcggcacg ggccgcaacg atgggcgcgg gtgtggtcat ggcggatctg       720
     gccctgtgtc aggaagagct gcgcgccgga acgcttgtgc ttccctttcc cgagatgacc       780
     tgcaccacac cgcaaggagg gtatgtcctg cttggtgcgc gcgcgcggtg ggacgagccc       840
     catctgcggg cgtttcgcga ctgggcggcc agtagctcgg ccgatcttgt ggcgtgcatg       900
     ggcgcctga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page