(data stored in ACNUC7421 zone)

EMBL: CP000031.PE320

CP000031.PE320       Location/Qualifiers
FT   CDS_pept        complement(342014..342577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0331"
FT                   /product="thiol:disulfide interchange protein, putative"
FT                   /note="identified by similarity to SP:P43221"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93649"
FT                   /db_xref="GOA:Q5LXC1"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXC1"
FT                   /protein_id="AAV93649.1"
FT                   /translation="MKKLLLALVYTAAALGANPSLGLAADRAQIEALRDGDMKKLIVLP
FT                   ETRAVSQVPFQLADGAGEATLGDYKGKVVLLNFWATWCAPCRKEMPQLSALQSELGGES
FT                   FEVLTIATGRNSPAGIEKFFGEIGVDNLPRHQDPRQALAREMAVIGLPITVLIGADGME
FT                   VARLIGDADWNSDSAKAIIQAVIE"
     atgaagaaac tgttgctcgc cctcgtctat accgccgccg cgctgggcgc aaatccatcg        60
     ctcggcctgg ccgccgaccg cgcgcagatc gaggcgctgc gcgatggtga catgaagaaa       120
     ttgatcgtgc tgcccgagac ccgtgcggtg tcgcaagtgc cgttccagct ggccgatggc       180
     gccggcgagg caacgctggg cgattacaag ggcaaggtgg ttctgctgaa cttctgggcc       240
     acctggtgcg ccccctgccg caaggagatg ccgcagctgt cggcgctcca gtccgagctt       300
     ggcggagaga gtttcgaggt gctgaccatc gccaccggcc gcaactcgcc cgccgggatc       360
     gagaaattct ttggcgagat cggggtcgac aaccttcccc gccaccagga cccgcgtcag       420
     gcgctggcgc gcgagatggc agtgatcggc ctgccgatca ccgtgctgat cggtgccgac       480
     gggatggagg ttgcccggtt gatcggcgat gccgactgga actcggacag cgccaaggcg       540
     atcatccagg cagtgataga gtga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page