(data stored in ACNUC9435 zone)

EMBL: CP000031.PE324

CP000031.PE324       Location/Qualifiers
FT   CDS_pept        345684..348242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93653"
FT                   /db_xref="GOA:Q5LXB7"
FT                   /db_xref="InterPro:IPR012683"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXB7"
FT                   /protein_id="AAV93653.1"
FT                   /translation="MTRNRPPNLPLPRFALGLTHAGLWAERLWRGFWPFLSVLMLALAP
FT                   ILLGLHELVPVEWVWAFAAGFALVLVVTLVLGLRRFRRPVRAEALARLDAALPGRPIQT
FT                   LMDEQAIGAQDPASAALWRAHQARMAARVANAEPVAPDLVLTRRDPYGLRFMAALCFVA
FT                   ALLFGSVWRVGSVVDLAPGAAQAATGPSWEGWIEPPRYTGLPTLYLNDQTGEVLQLPQG
FT                   SRITLRLYGEVGQLRLTEEVSGKPLERPDHPEQTVEVTRSGPFEIEGRGGRGWQVVMLS
FT                   DTAPQVEIAGAAETRAGGQMVLPFAAMDDYGITGGRAVIALDLEAVDRRYGLRTDPDPR
FT                   DPVVADLPLPITGDRREFTENLIEDFSQHPWAHLPVTITLIAQDAAGQEAETLPFGTAL
FT                   PARRFFDPLAAAVIEQRRDLLWSRDNATRVAQILRAVSHRPDDVFRSQTAYLRLRVILR
FT                   RMEALQRFGLKPAQQEEIAQALWDLAIMLEDGTLSDALERMRRAQERLSEAMKNGASDQ
FT                   EIAELMQELREATQDYLRQLAQNQQNEQDGERQAQEGESLQMTQDDLQKMMDRIQELME
FT                   QGRMAEAQQALEEFQQMMENMRVTQGQGDNGQSEGQRAMEGLAETLRNQQGLSDQAFRD
FT                   LQEQFNPGAQAGESQQNEGRNGGEGRGQSHEGQGQGSRQSGTGQDGAQQGEPGETGEGS
FT                   LAERQQALRNELGRQEQNLPGQGTPEGDAAREALDRAGRAMEGAEEALRENDLAEAIDR
FT                   QAEAMEAMREGMRSLGEALAQQSQPGQGSQEGDQRARNQDPLGRTPGSQGGVDTDESLV
FT                   PGDDVYRRARDLLDEIRRRSGESDRPKVERDYLKRLLDRF"
     gtgacccgaa accgcccgcc taacctgccc ttgccgcgct ttgcgttggg tctgacccat        60
     gcaggccttt gggccgaacg gttgtggcgg gggttctggc ccttcctctc ggtgctgatg       120
     ctggcactgg caccgattct gctgggcctg cacgagctcg tgccggtgga atgggtctgg       180
     gcctttgcgg ccggatttgc gctggtgctg gttgtgacgc ttgtactggg tctccggcgg       240
     tttcgcagac cggtccgggc cgaggcgctg gcgcggcttg acgcggcctt gccggggcgc       300
     ccgatccaga ccttgatgga cgagcaggcg ataggcgcgc aggatccggc ttcggccgcg       360
     ctctggcggg cgcatcaggc ccgcatggcg gcgcgggtcg caaacgccga accggtggct       420
     cccgatctgg tgctgaccag acgcgacccc tatgggctgc gcttcatggc tgcgctgtgt       480
     ttcgtggcgg cgctgctctt cggctcggtc tggcgggtgg gcagcgtggt cgatctggcg       540
     ccgggtgcgg cgcaggcggc gaccggaccc agctgggagg gctggatcga gccgccacgc       600
     tataccggtc tgccgacgct ttatctgaac gaccagacgg gcgaggtgct gcaactgccc       660
     cagggcagcc gcatcacgct gcggctttat ggcgaggtgg gacagctgcg cctgaccgag       720
     gaggtctcgg gcaagccgct ggagcggccc gaccatccag aacagacggt cgaggtcacc       780
     cgcagcggtc ccttcgagat cgaaggacgc ggtggccggg gatggcaagt ggtgatgctc       840
     tcggacaccg cgccgcaggt cgagattgcg ggcgcggccg aaacccgggc gggcggacag       900
     atggtgctgc cctttgccgc gatggatgat tacggcatca ccggcggacg ggcggtgatc       960
     gctctggatc tggaggcggt cgaccgtcgc tatggcctgc gcaccgatcc ggacccgcgc      1020
     gatccggtgg tggccgatct gcccttgccg atcaccggtg atcggcgcga attcaccgaa      1080
     aacctgatcg aggatttctc gcagcaccct tgggcgcatc tgccggtgac gatcaccctg      1140
     atcgcgcaag acgcagccgg gcaggaggcc gagacgctgc cctttggcac cgcattgccg      1200
     gcgcggcgtt tctttgaccc gctggccgca gccgtgatcg aacagcgccg cgacctgctt      1260
     tggtcgcgcg acaatgccac gcgcgtggcg cagatattgc gcgctgtctc gcaccgcccc      1320
     gatgacgtgt tccgctcgca aacagcttat ctgcggctgc gggtcattct gcgccggatg      1380
     gaggcgttgc agcgctttgg gctgaaaccg gcgcaacagg aagagatcgc ccaggcgctc      1440
     tgggacctgg cgatcatgct tgaggacggc accctgtcgg atgcgctgga acggatgcgc      1500
     cgggcgcagg aacggctgag cgaggcgatg aagaacggtg cctcggacca ggagatcgcc      1560
     gagctgatgc aggaactgcg cgaggcgacg caggactatc tgcgccaact ggcgcagaac      1620
     cagcagaacg agcaggatgg cgagcggcag gcgcaggagg gtgaaagcct gcaaatgacg      1680
     caggacgacc tgcaaaagat gatggaccgc atccaggaac tgatggaaca gggccgcatg      1740
     gccgaggcgc agcaggcgct ggaagagttc cagcagatga tggagaacat gcgcgtgacc      1800
     cagggccagg gcgacaacgg ccagtccgaa gggcagcgcg cgatggaagg cctggccgag      1860
     accctgcgca accagcaggg gctcagcgat caggcttttc gcgatcttca ggaacagttc      1920
     aacccgggcg cgcaggcggg cgagagccag cagaacgagg gccgcaacgg gggcgagggc      1980
     cgcgggcaga gccatgaggg tcagggccag ggcagccgcc agtcgggcac cggacaggac      2040
     ggcgcccagc agggcgagcc cggagaaacg ggtgaggggt ctctggccga gcggcagcag      2100
     gcgctgcgca acgagctggg acggcaggaa cagaacctgc ccggacaggg cacgcccgag      2160
     ggcgacgccg cgcgcgaggc gctggaccgg gccgggcgcg cgatggaagg cgccgaagag      2220
     gcgctgcgcg agaatgatct ggccgaggcg atcgaccggc aggccgaggc gatggaggcg      2280
     atgcgcgagg gcatgcgctc gctgggcgag gcgctggcgc agcaaagcca gccgggacag      2340
     ggcagccagg agggcgacca gcgcgcccgc aaccaggacc cgctggggcg gacgcccgga      2400
     tcgcagggcg gtgtcgatac cgacgagtcg ctggtgccgg gcgacgatgt ctatcgccgg      2460
     gcgcgcgatc tgctggatga gatccgccgc cgctcgggag agagcgaccg gcccaaggtc      2520
     gaacgcgatt acctcaaacg cctgctcgac cggttctag                             2559
//

If you have problems or comments...

PBIL Back to PBIL home page