(data stored in ACNUC7421 zone)

EMBL: CP000031.PE327

CP000031.PE327       Location/Qualifiers
FT   CDS_pept        349968..350867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0338"
FT                   /product="cell division permease protein FtsX, putative"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93656"
FT                   /db_xref="GOA:Q5LXD3"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXD3"
FT                   /protein_id="AAV93656.1"
FT                   /translation="MSKGTIRALLMADKQADRVVPPSGFTAQLTLFVSGAMAFLAVFAL
FT                   ALSLASGRLADRWASELAQAATLRINAPADQVAAQTQAALAILIQTPGVAEARALSREE
FT                   QAALLTPWFGPDLPLDTLPVPQLIEIVGGTPAYDAQGLRLRLAAEVPGAVLDDHRRWRE
FT                   PLVDAANSLRRLALVSILLIGGATAAMITLAANAALAANSQVIEVLRLVGARDRYIAGA
FT                   FVRRFTLRALIGAAVGVLLGMGGVMLLPEASDEGGFLTGLGFRGIGWLLPLLIPVLGAV
FT                   VAFAATWHAARRRLKELA"
     gtgagcaagg gaacgatccg cgcattgctg atggccgaca agcaggccga ccgggtggtg        60
     ccgccctcgg gctttaccgc gcaactcact ctgttcgtct ccggtgccat ggcctttttg       120
     gcggtgttcg cgctggcgct gtcgctggcc tcggggcgtc tggcggatcg ctgggcctcg       180
     gaactggcgc aggcggcaac gctgcggatc aacgcgcccg ccgatcaggt cgcggcgcag       240
     acccaggcgg cgctggccat cctgatacag acaccgggcg tggccgaggc ccgcgcgctc       300
     agccgcgagg aacaggcggc gctgctgacg ccctggttcg gccccgacct gccgctggac       360
     accttgccgg tgccgcagct gatcgagatc gtcggaggca cccccgccta tgacgcccaa       420
     ggactgcggc tgcggctcgc agccgaggtg cccggcgcgg tgcttgacga tcaccgacgc       480
     tggcgcgagc cgctggtgga tgcggccaat tcgctgcggc gtctggcgct ggtgtctatc       540
     ctgctgatcg gcggtgccac cgcggcgatg atcacgctgg cggcaaatgc cgcattggca       600
     gccaattccc aggtgatcga ggtgctgcgg ctggtcggcg cgcgcgaccg ctatatcgcg       660
     ggcgccttcg tgcgccggtt taccctgcgc gcgctgatcg gcgcggcggt gggggtgctg       720
     ttgggcatgg gcggtgtcat gctgctgccc gaggcctcgg acgagggcgg ttttctgacc       780
     gggctcgggt tccggggtat cggatggctg ttgccgctgc tgatcccggt tttgggcgcg       840
     gtggtggcct ttgccgccac ctggcatgcg gctcgccgca ggttgaagga gcttgcatga       900
//

If you have problems or comments...

PBIL Back to PBIL home page