(data stored in ACNUC7421 zone)

EMBL: CP000031.PE328

CP000031.PE328       Location/Qualifiers
FT   CDS_pept        350864..351595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0339"
FT                   /product="acyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93657"
FT                   /db_xref="GOA:Q5LXD2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXD2"
FT                   /protein_id="AAV93657.1"
FT                   /translation="MMMQWVRSIVFTIVIYIWMAILGLLFTPYALVSKKGALRACKLYA
FT                   RSTIWMARWMVGIHGEIRGPVPTGEVLIAAKHQSFFDILLIFHAVPHGKFIMKRELLWT
FT                   PVIGVYAKRLGCIPVNRGKRGAAVARMVKDVAKEFAEPGQLVIYPQGTRVAPGVSKPYK
FT                   VGSAVLYEGLQYSCIPVATNVGLFWPRDGLLRKPGRAVVEFLEPIPPGVPRDAFMRRLE
FT                   TEIEGASDRLMREAGYETAQG"
     atgatgatgc agtgggtgcg ttccatcgtc tttaccatcg tcatctatat ctggatggcc        60
     atcctggggc tgctctttac cccttatgcg ctggtctcga agaagggcgc gctcagggcc       120
     tgcaagcttt atgcgcgcag caccatctgg atggcgcgct ggatggtcgg cattcatggt       180
     gagatacgtg ggccggtgcc gacgggtgag gtgctgatcg ccgccaaaca ccagtcgttc       240
     tttgacatcc tgctgatctt tcacgcggta ccgcatggca agttcatcat gaaacgcgag       300
     ctgttgtgga cgccggtgat cggggtctat gccaagcgcc tgggctgcat cccggtgaac       360
     cggggcaagc gcggggcggc ggtggccagg atggtcaagg acgtggccaa ggaatttgcc       420
     gagcccggcc aattggtgat ctatccgcag ggcacacggg tcgcaccggg cgtgtccaaa       480
     ccctataagg tgggcagtgc ggttctgtat gaggggctgc aatacagctg cattccggtg       540
     gcgaccaatg tcgggctgtt ctggccgcgt gacgggctgc tgcgaaagcc ggggcgcgcg       600
     gtggtcgagt tcctggaacc gattccgccg ggtgtgccgc gtgatgcgtt catgcggcgc       660
     ctggagaccg agatcgaggg cgcctcggac cggttgatgc gcgaagcagg atatgagacc       720
     gcgcagggtt ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page