(data stored in ACNUC7421 zone)

EMBL: CP000031.PE330

CP000031.PE330       Location/Qualifiers
FT   CDS_pept        complement(353181..353450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0342"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93658"
FT                   /db_xref="GOA:Q5LXC9"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXC9"
FT                   /protein_id="AAV93658.1"
FT                   /translation="MATHALWQADVADFDAWLKVFREDRAMRKAAGIRDLHIWRDPDRA
FT                   DHAVALFEITNLASAQAFFDSEELAMHHERGGIAHITVKLLTPV"
     atggcaaccc atgccctctg gcaggccgat gtggccgatt tcgacgcctg gctcaaggtg        60
     ttccgcgagg atcgcgcgat gcgcaaggcg gcgggcatcc gcgacctgca tatctggcgc       120
     gacccggatc gcgccgatca tgcggtggcg cttttcgaga tcaccaacct cgcctctgcc       180
     caggcctttt tcgacagcga ggaactggcc atgcatcacg aacgcggcgg catcgcccat       240
     atcacggtga agctgctgac accggtctga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page