(data stored in ACNUC7421 zone)

EMBL: CP000031.PE333

CP000031.PE333       Location/Qualifiers
FT   CDS_pept        complement(358122..358784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0344a"
FT                   /product="hypothetical protein"
FT                   /note="'Novel gene detected by proteogenomics, SPO_PG005;
FT                   not identified in other Roseobacter strains'"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0344a"
FT                   /db_xref="EnsemblGenomes-Tr:AHB86005"
FT                   /db_xref="GOA:V5UZC2"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:V5UZC2"
FT                   /protein_id="AHB86005.1"
FT                   /translation="MFGPISGQVHGTGAKALVIVLHGDSGPDYITSFAADLARRNPQST
FT                   VIQMARPGYSIAGRRSKGSNSGSRDHYTKQNNNLLAQGISAASQAYPHNRLVVVAHSGG
FT                   AAQTGTLLGTVPGLIDIAVMVSGPFDIPRWRASRGTPWPKSQSPIRYLDQIPRQTKIIA
FT                   VTGQQDSNTQPGLARDYVAKAQARGLNATFTAIPNAGHSFRSLKEPVLAIATREIQS"
     atgttcggac cgatctcagg ccaggtgcac ggcaccggag ccaaggcgct ggtcatcgtt        60
     ctgcacgggg attccggccc ggattacatc acatcctttg ccgccgacct ggcccggcgc       120
     aatcctcagt caaccgtcat ccagatggcg cggccgggct attccattgc ggggcgccga       180
     agcaagggct ccaacagcgg tagccgcgat cactatacca agcagaacaa caatctgctc       240
     gcacagggca tctcggctgc cagccaggcg tatccgcata acaggctcgt ggtggtggct       300
     cattccggcg gcgcagcaca gaccggcaca ttgctgggaa cggtgccggg ccttatcgac       360
     atagcagtga tggtatccgg cccattcgac attccgcgct ggcgcgcgtc gcgcggtacg       420
     ccctggccca agagccagtc accaattcgc tacctcgacc agataccacg acagaccaag       480
     atcatcgcgg tgacaggcca gcaggattca aacacccaac cgggccttgc ccgggactat       540
     gtggcaaagg cccaggcgcg cggcctgaac gccacattca ccgccatacc gaatgcaggc       600
     cacagtttca gatcgctcaa agaacccgtt ctggccatcg cgacgcgcga aatccagagc       660
     tag                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page