(data stored in ACNUC7421 zone)

EMBL: CP000031.PE34

CP000031.PE34        Location/Qualifiers
FT   CDS_pept        complement(34823..36502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0035"
FT                   /product="core-2/I-branching enzyme family protein"
FT                   /note="identified by match to protein family HMM PF02485"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93366"
FT                   /db_xref="GOA:Q5LWI5"
FT                   /db_xref="InterPro:IPR003406"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWI5"
FT                   /protein_id="AAV93366.1"
FT                   /translation="MLVHTALDRAQQVAQHWTASGCPVVIHVDRKVSRKTFKAFHDACV
FT                   KDPLIRFSTRHRCEWGTWGIVAASQAASEQMLAEFADVRHVYLASGSCLPLRPVQELID
FT                   YLAARPRTDFIESATTADVPWTVGGLDQERFTLRFPFSWKKHRYLFDKYVNLQRRLGFK
FT                   RRIPAGLVPHMGSQWWCLTRHTLSAILEDPERTVYDAYFRKVWIPDESYFQTLARQFSA
FT                   NIESRSLTLSKFDFQGKPHIFYDDHLQLLRRSDCFVARKIWPRAERLYQAFLTDQAGAM
FT                   KRTEPNPGKIDRIFAKAVERRTRGRDGLYMQSRFPRHGNENGLTSNPYSVFQGFTELFE
FT                   DFEPWLAKATGTRVHGHLFGPERAEFAGGERLVNGALSDCALLRDYNPTSFLTSLIWNT
FT                   RGERQCFQFGPADNQKIDWLLARDPNAQISVITGAWAVPLFKSNRNFADLRKEAARLQR
FT                   IESKHLEILRSVWTKARVRIWTMAEFVEAPMEPIQTIVDEIGQSSPRRLTEAPTMVDLT
FT                   GFGQFLQNLKNQGMHPYLMGDFPVEPAPINNPKPTRKPYLVR"
     atgctggttc acaccgcgct cgaccgggcg cagcaggtgg cgcagcattg gaccgcctcg        60
     ggctgtcctg ttgtgatcca tgtcgaccga aaggtgtccc gcaagacgtt caaggcgttt       120
     cacgatgcct gcgtcaagga cccgctgatc cggttcagca cccgccaccg ctgcgaatgg       180
     ggcacctggg ggatcgtcgc cgcctcgcag gccgcgtccg agcagatgct ggccgaattc       240
     gccgatgtgc gccatgtcta ccttgcctcc ggttcctgcc tgccgctgcg tccggtgcaa       300
     gagctgatcg actatctcgc cgcccggccg cgcaccgatt tcatcgaaag cgccaccacc       360
     gcagatgtgc cctggaccgt gggcgggctg gatcaggaac gctttaccct gcgctttccc       420
     ttctcgtgga aaaagcaccg ctatctgttc gacaaatacg tcaatctgca acggcgcctg       480
     gggttcaaac gcaggatacc tgccgggctg gtgccgcata tgggaagcca gtggtggtgc       540
     ctgacgcggc acaccctctc ggctatcctc gaggaccccg agcgcaccgt ctatgacgcg       600
     tatttccgca aggtctggat cccggatgaa agctatttcc agactctggc gcggcagttc       660
     tcggccaata tcgaaagccg ctcgctgacg ttgagcaagt tcgatttcca gggcaaaccg       720
     catatcttct acgacgatca cctgcaattg ctgcggcggt ccgactgttt cgtcgcccgc       780
     aagatatggc cccgggcgga acggctgtat caggcctttc tgaccgatca ggccggcgcc       840
     atgaaacgga ccgagccgaa cccgggcaag atcgaccgca tctttgccaa ggcggtcgag       900
     cggcggacgc ggggccgcga cggcctgtat atgcaaagcc gctttccccg ccacggcaac       960
     gagaacggcc tgacctcgaa cccctattcc gtgttccagg gctttaccga actgttcgag      1020
     gatttcgagc cctggctggc caaggccacc ggcacccgtg tgcatgggca tctctttggc      1080
     cccgagaggg ccgaattcgc cggcggcgag cggctggtca acggcgcgct cagcgattgc      1140
     gccctgctgc gcgactataa cccgaccagt ttcctgacct cgctgatctg gaacacaagg      1200
     ggcgagcggc agtgtttcca gttcggcccc gccgacaatc agaaaatcga ctggctgctg      1260
     gcgcgcgacc ccaacgccca gatttcggtc atcaccggcg cctgggcggt gccgctgttc      1320
     aaatcgaacc gcaacttcgc cgacctgcgc aaagaggccg cgcgcctgca acggatcgaa      1380
     agcaagcatc tggaaatcct gcgttcggtc tggaccaagg cgcgggtgcg gatctggacg      1440
     atggccgaat tcgtcgaggc gcctatggag ccgatccaga ccatcgtgga cgagatcggg      1500
     caatcaagcc cgcgccgcct gaccgaagcg ccaaccatgg tggatctgac cggcttcggc      1560
     cagttcctgc agaacctcaa gaaccagggc atgcacccct atctgatggg ggatttcccg      1620
     gtcgaaccgg ccccgatcaa caaccccaaa ccgacacgca aaccctatct ggtgcgataa      1680
//

If you have problems or comments...

PBIL Back to PBIL home page