(data stored in ACNUC9435 zone)

EMBL: CP000031.PE340

CP000031.PE340       Location/Qualifiers
FT   CDS_pept        364683..365438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0350"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF01925"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93668"
FT                   /db_xref="GOA:Q5LXE0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXE0"
FT                   /protein_id="AAV93668.1"
FT                   /translation="MLEPDIGFFAVTIPAVIFAGISKGGFGSGVAFASASILAIYLDPG
FT                   QALALMLPLLMLIDLATLKPYWRRWSWPDARLLILGGLPGVALGALLYRATDADLLRLL
FT                   IGGISLAFVAWQMLRGRGWMREFASRLPPAAGLLAGAVAGFTSFVSHAGGPPAAVYLLS
FT                   QRLGKTEFQATTVLTFWALNIAKFVPYAWLGMFTLDTARAGLLLAPFALLGAWLGVRAH
FT                   HMVPERAFFALAHAMLTLTGLKLIWDALV"
     gtgctggaac cggatatcgg ctttttcgcg gtgaccattc cggcggtgat ctttgcgggt        60
     atttccaagg gtgggttcgg ttcgggtgtg gcctttgcct cggcctcgat tctggcgatc       120
     taccttgacc cagggcaggc gctggcgctg atgctgccct tgttgatgct gatcgacctg       180
     gcgacgctaa agccctattg gcgccggtgg agctggcccg acgcccgatt gctgatcctg       240
     ggtggattgc ccggcgtggc gctcggtgcg ctgctctatc gcgcgaccga tgccgatttg       300
     ttgcgtctgc tgatcggggg gatttcgctg gcgtttgtgg cctggcagat gctgcgaggg       360
     cgcgggtgga tgcgcgaatt cgcctcgcgc ctgccccctg cggccggttt gctggcgggg       420
     gcggttgccg ggttcaccag ctttgtcagc catgcgggcg ggccgccggc tgcggtctat       480
     ctgctgtcgc aaaggctggg aaagaccgag tttcaggcca ccacggtgtt gaccttctgg       540
     gcgctcaaca tcgccaagtt tgttccctat gcctggctgg ggatgttcac cctggacacc       600
     gcgcgggcgg gtctgctgct ggcacccttt gccctgctcg gggcctggct gggtgttcgg       660
     gcccatcata tggtgccgga acgggccttt ttcgcgctgg cgcatgccat gctaacactg       720
     accgggctca agctgatctg ggacgcgctc gtctga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page