(data stored in ACNUC7421 zone)

EMBL: CP000031.PE341

CP000031.PE341       Location/Qualifiers
FT   CDS_pept        complement(365521..365835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0351"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAC45660.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93669"
FT                   /db_xref="GOA:Q5LXD9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXD9"
FT                   /protein_id="AAV93669.1"
FT                   /translation="MKTMMIKMTMGLGLMALAAGQLQAQGNNCAPRQMVLDQLAQKYGE
FT                   ARRGIGLVQQGSVMEVFASDETGTWTITVTLPNGMTCMVASGQSYEALAEALPTSGNDA
FT                   "
     atgaagacga tgatgatcaa gatgacgatg ggcctgggcc tgatggcact ggccgccggc        60
     cagcttcagg cgcagggcaa caactgcgcg ccgcgccaga tggtgctgga ccaactcgcg       120
     cagaaatatg gcgaggcgcg gcgcggcatc gggctggtgc aacaaggctc ggtgatggag       180
     gtttttgcct cggacgagac cggaacctgg accatcacgg tgaccctgcc caatggcatg       240
     acctgcatgg tggccagcgg ccagtcctat gaggcactgg ccgaggcgct gccaaccagc       300
     ggcaacgacg cctga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page