(data stored in ACNUC7421 zone)

EMBL: CP000031.PE344

CP000031.PE344       Location/Qualifiers
FT   CDS_pept        367576..367782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0354"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:AE3561"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93672"
FT                   /db_xref="GOA:Q5LXD6"
FT                   /db_xref="InterPro:IPR013619"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXD6"
FT                   /protein_id="AAV93672.1"
FT                   /translation="MAKLYRLLTEEDTAAFCHKVSDALAKGWELYGSPAYAYDAANGIM
FT                   RCAQAVTKEVEADYSPDMKLGQH"
     atggccaagc tttatcgcct tctgaccgag gaggacaccg ccgctttctg ccacaaggtc        60
     tcggatgcgc tggccaaggg gtgggagctt tatggctccc ccgcctatgc ctatgacgcg       120
     gccaacggca tcatgcggtg cgcccaggcg gtgaccaagg aggtcgaggc agactattcc       180
     cctgacatga aactgggaca gcactaa                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page