(data stored in ACNUC7421 zone)

EMBL: CP000031.PE345

CP000031.PE345       Location/Qualifiers
FT   CDS_pept        367782..368810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0355"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:AAK25618.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93673"
FT                   /db_xref="GOA:Q5LXD5"
FT                   /db_xref="InterPro:IPR016790"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXD5"
FT                   /protein_id="AAV93673.1"
FT                   /translation="MAKTNPGRFFEDYTVGQTLHHAVPRTVTNGERALYHALYPARHAL
FT                   YSSDAFAQSCGLPGSPIDDLAAFHVVFGKTVPDVSLNAVANLGYAEGRWLKPVYAGDTL
FT                   RSVSEVIGLKQNSNGKTGVVYVRTRGLNQRDETVMEYVRWVMVRKRDLDAPAPEIVVPE
FT                   LKKALAPNDLVVPEGLDFTAYDFALAGEPHRWGDYAVGETIDHVDGVTVEEAEHMLATR
FT                   LWQNTAKVHFDLTFRPDGRLIYGGHVISMARALSFNGLANAQIIVGLNGGAHANPCFAG
FT                   DTIKAWTEVLDKAETAAPGVGALRLRLVATKGGAPFALHGEDGKYLPEVLLDLDYWVLM
FT                   PK"
     atggcaaaga ccaatccggg ccgctttttc gaagactaca ctgtcggcca gaccctgcat        60
     cacgcggtgc cgcgcaccgt gaccaatggc gagcgcgcgc tctatcatgc gctctatccc       120
     gcgcggcatg cgctgtattc ttcggacgcg tttgcgcaat cctgcggcct gccgggcagc       180
     ccgatcgacg atctggcggc gttccacgtg gtcttcggaa agacggttcc ggatgtgtcg       240
     ctgaacgcgg tggccaatct cggctatgcc gagggccgct ggctgaagcc ggtctatgct       300
     ggggatacgc tgcgctcggt ttccgaggtg atcgggctga aacagaactc taacggcaag       360
     accggggttg tctatgtccg cacgcgcggg ctgaaccagc gcgacgagac cgtgatggaa       420
     tatgtccgct gggtgatggt gcgcaaacgc gacctggatg cgcccgcgcc cgaaatagtg       480
     gtgcccgagc tgaaaaaggc gttggcgcca aacgatctgg tggtgcccga ggggttggat       540
     ttcacggcct atgatttcgc gctggcgggc gagccgcacc gctggggcga ttatgcggtg       600
     ggcgaaacca tcgaccatgt ggatggtgtc acggtggaag aggccgagca tatgctggcc       660
     acccgcctgt ggcagaacac ggccaaggtg catttcgacc tgaccttccg ccccgatggg       720
     cggctgatct atggcgggca tgtgatctcg atggcgcggg cgttgagttt caacgggctg       780
     gccaatgcgc agataatcgt cgggctgaac ggcggggcgc atgccaatcc ctgctttgcc       840
     ggcgacacga tcaaggcctg gaccgaggtg ctggacaagg ccgagaccgc agcgcccggc       900
     gtcggagcgc tgcgcctgcg gctggtggcc accaagggtg gcgcgccctt tgcgctgcac       960
     ggcgaggatg gcaaatacct gcccgaggtg ctgctcgatc tggactattg ggtgctgatg      1020
     ccgaaataa                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page