(data stored in ACNUC9435 zone)

EMBL: CP000031.PE346

CP000031.PE346       Location/Qualifiers
FT   CDS_pept        368789..369547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0356"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC61369.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93674"
FT                   /db_xref="GOA:Q5LXD4"
FT                   /db_xref="InterPro:IPR025644"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXD4"
FT                   /protein_id="AAV93674.1"
FT                   /translation="MGADAEIISAFHLGDFGMRFVLSALLCLATPVAADDADFVRSNLT
FT                   AILYHEFGHALIDILGLPVFGQEEDAADVASILLIDALYEEAGATDIAIDAAFGFLAEA
FT                   EAVGDEIAWWDVHGPDLQRYYNLVCLFAGADLESRSDIALELDLPQERLDSCGEEFDIA
FT                   YDSWGPVLDEISGAGQSMTYVGPKAGLSAEVVSEEVAVFNDLFHLPEPLEFRVEPCGEA
FT                   NAYYDPEAVSITLCTEFEDWLFEQAPLTRM"
     ttgggtgctg atgccgaaat aatctccgcg ttccaccttg gagatttcgg gatgcgtttc        60
     gttctgtctg ctctgctgtg cctggccacg ccagtcgcgg cggatgacgc ggatttcgtc       120
     aggtccaacc tgactgcgat cctgtatcat gaatttggcc atgcgctgat cgacattctg       180
     gggctgcccg ttttcgggca ggaagaggat gccgccgatg tggcctcgat cctgctgatc       240
     gacgccttgt acgaagaggc gggagccacc gatatcgcca tcgacgccgc ctttggcttt       300
     ctggccgagg ccgaggccgt cggcgatgag atcgcctggt gggatgtgca tgggcctgac       360
     ctgcaacgct attacaacct ggtttgcctc tttgccggcg cagatttgga atcccggtct       420
     gacatcgcgc tggaactgga cctgccgcaa gagcggctgg acagttgtgg cgaggagttc       480
     gacatcgcct atgacagctg ggggccggtc ctggatgaga tttcgggggc aggtcagagc       540
     atgacctatg tcggcccgaa ggcgggcctg agcgccgagg tggtgtcaga ggaggtcgcg       600
     gttttcaacg atctgttcca cctgcccgaa ccgctcgaat tccgggtcga accctgtggc       660
     gaagcaaatg cctattacga tcccgaggcg gtctcgatca ccttgtgcac cgaattcgag       720
     gactggctgt tcgaacaggc gccgctgaca cgcatgtga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page