(data stored in ACNUC7421 zone)

EMBL: CP000031.PE347

CP000031.PE347       Location/Qualifiers
FT   CDS_pept        369582..370244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0357"
FT                   /product="von Willebrand factor type A domain protein"
FT                   /note="identified by match to protein family HMM PF00092"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93675"
FT                   /db_xref="GOA:Q5LXF1"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR010607"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXF1"
FT                   /protein_id="AAV93675.1"
FT                   /translation="MSFWRVFLFGLFLTPPAAACDLALALAVDVSGSVDEGEYRTQMDG
FT                   LAHALRDPVVSEALVRAEAQLMLVQWTGSDRQRVTIPWTQASSFDALDRFADRVAADPR
FT                   IWRNYSTAIGEALEVTMAAFAQVPDCARHLIDVSGDGPSNEGIEPLAVHRDLRALGITV
FT                   NAIAIEQSEPDLTAYFYENVIVGEGAFVETANGFADYPARIRKKLLREVTQQTAALD"
     atgtctttct ggcgcgtatt cctctttggc cttttcctga ccccgcccgc agccgcttgc        60
     gatctggccc tggcgcttgc ggtggatgta tccgggtccg ttgatgaggg cgaataccgc       120
     actcagatgg acgggctggc ccatgcgctg cgcgatccgg tggtgtccga ggcgctggtg       180
     cgggcagagg cacagttgat gttggtgcaa tggaccggct ctgaccgcca gcgggtgacc       240
     atcccctgga cccaggccag cagcttcgac gcactggatc ggttcgccga ccgggtcgcc       300
     gccgacccgc gcatctggcg caactattcc accgcgatcg gcgaggcgct ggaagtcacc       360
     atggcggcat ttgcccaggt tcccgattgc gcccgccatt tgatcgacgt ttccggcgat       420
     ggaccctcga acgaggggat cgagccgctg gcggtgcatc gcgatctgcg cgcgctgggg       480
     attacggtga atgccatcgc catcgagcag agcgagccgg acctgaccgc ctatttctat       540
     gaaaatgtca tcgtgggcga gggggccttt gtcgaaaccg ccaatggctt tgccgactat       600
     cccgcccgca tccgcaaaaa actgctgcgc gaggtcacgc agcagaccgc ggcattggac       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page