(data stored in ACNUC9435 zone)

EMBL: CP000031.PE353

CP000031.PE353       Location/Qualifiers
FT   CDS_pept        374164..376323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0362"
FT                   /product="type I secretion target repeat protein"
FT                   /note="identified by match to protein family HMM PF00353"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93680"
FT                   /db_xref="GOA:Q5LXE6"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXE6"
FT                   /protein_id="AAV93680.1"
FT                   /translation="MPTLTELNSEYSVVSSGLAQSGPQNAALSDGRQVVTWQTRTGLLY
FT                   FKIVDSEGKSTGSSTLVSTIVGPNSPSDVKTLSDGSFIVVYTEQISSNNSEIRATRYSD
FT                   TGQKIGTEMNLMTDAREILFAPTVTSLSDGGFAVLSGGYSSSDSDHSTFVRAFDIDGTP
FT                   RGPMAQLDLTTAGKQVFPEAVGVENGGLVAVWTSGTGDGSGTSVKMRLVDGNGVPQGRE
FT                   IQVNQYTPSDQQEPAIARLDDGSVIVVWHSKGQDGSEGSIIARHFSAQGVPQGNEFIVN
FT                   VTRAGEQTLPTVVALNEGGFVVAWTNLTSRPDTMARQYDYNLRPVTGEIKLSQGSLSRD
FT                   IGPELSALSNGGVGFVWMDISVVASLPTLGVEVRTTHPSDFNPTEGNDLLSGDAGNNRI
FT                   FARDGDDWVSPGIGSDTVDGGAGNDMVSFIDHRQAVRVDLSEGRVTSGRDINHLSNVEN
FT                   VTGSSFADYIVGDDGDNRLRGAGSYDWFIGSDGADFYDGGSGRDMVSYVSSSGAVQVDL
FT                   TRGRGQGGMAEGDRYQSIERVTGSSFEDHLTGDAGDNDLRGLGSYDWFVGTAGRDRYDG
FT                   GSGLDMISYASSSAAVSVDLSQGRGTRGDAAKDSYVSVERVTGSSHDDVLIGDDGRNVL
FT                   RGLYGEDTLLGNAGVDRLHGGASDDFLDGGAGWDFAIFDGNRDDYNVTRQGERTLVERV
FT                   SPGNEGIDTLVNIEVIQFQDDFLYL"
     atgccgaccc taactgaact aaactccgaa tacagcgttg tctccagtgg gcttgcacag        60
     agtgggcctc agaacgccgc gctctctgat gggcgacaag tcgtaacctg gcagaccaga       120
     accggtttgc tttacttcaa aatcgtggat tcagaaggca agtccacggg ctcttcaacg       180
     ctggtctcga ctatcgttgg accgaattcc cctagtgatg tcaaaacgtt gtcggatggc       240
     agctttattg tcgtctacac agagcaaatc tcttcgaaca acagcgaaat tcgtgcgacc       300
     cgctattcgg acacgggtca gaagatcggt acagagatga atctgatgac cgatgccagg       360
     gaaatcctgt ttgctccaac ggtcacctct ctttctgatg gtgggtttgc cgtattatcg       420
     ggcggataca gttcgagcga tagcgatcat tcgacttttg tcagggcttt cgatatagat       480
     ggcacgccgc gcgggccgat ggctcaactg gatttgacca ctgcgggcaa acaggttttc       540
     cccgaagcgg ttggtgtcga aaatggcggc ctggttgctg tctggacttc tggaaccggc       600
     gatggctctg gcacctcggt caagatgcga cttgtcgatg gaaacggggt tcctcaggga       660
     cgcgaaatac aagtcaatca atacacgcct agcgatcaac aagagccggc aatcgcgcgt       720
     cttgatgacg gcagtgtcat cgttgtctgg cattcgaagg gtcaggatgg cagcgaaggt       780
     tcaatcatcg cgcgtcactt ttcggcccaa ggtgtcccgc agggaaacga attcatcgta       840
     aacgtgacac gcgcaggtga gcagacgctg ccaaccgtgg tcgccttgaa cgagggcggg       900
     ttcgttgtcg cctggacgaa tctcacgtct cgcccggata cgatggcacg acagtatgat       960
     tacaatttgc gtcctgtgac cggagaaatc aaactgtctc agggaagcct ctcccgcgat      1020
     attgggcccg agctttccgc attgtccaac ggcggtgtcg gatttgtctg gatggacatt      1080
     tccgtcgtcg cttccttgcc cacccttggt gtcgaggttc gaacaaccca tccttcggat      1140
     ttcaacccga ccgaggggaa tgatctgctt tcgggcgacg ccggcaacaa caggatcttt      1200
     gcccgtgatg gagacgattg ggtctcaccc ggaatagggt cggacacggt cgatggtggc      1260
     gcgggcaacg atatggtcag tttcattgat caccggcagg ctgtacgtgt cgatttgtca      1320
     gagggccggg tgacgtcggg tcgggatatc aaccatttgt cgaatgtcga aaacgtcacc      1380
     gggtcaagct ttgccgatta catcgtcggt gacgatggcg ataaccgttt gcgtggtgcc      1440
     ggcagctatg actggttcat tggatcggac ggcgctgact tctacgatgg cggttccggt      1500
     cgcgatatgg tcagctacgt ctcttcctct ggtgcggttc aggtggatct gacccgtggg      1560
     cggggccagg gtgggatggc cgagggggat cgttaccaga gtatcgaacg cgtgacgggt      1620
     tcgtcgttcg aagatcacct aacaggtgat gccggtgata atgacttgcg cgggctgggc      1680
     agctacgatt ggtttgtagg caccgcaggt cgcgaccgct acgacggcgg ctctgggctg      1740
     gatatgatca gctatgcatc gtcatccgcc gccgtttccg tagacctgtc acagggacgg      1800
     ggaacaagag gcgatgcagc taaagacagt tatgtcagcg tcgaacgcgt tactggcagc      1860
     agtcatgacg atgtcctgat tggtgatgac ggtcgaaacg tgctgcgcgg tctctatggc      1920
     gaggacacat tgttgggcaa tgcaggcgtt gatcgtctgc atggcggtgc gtccgatgac      1980
     tttctggatg gtggtgccgg ttgggacttt gccatctttg acggcaatcg cgacgactac      2040
     aatgtaaccc ggcaaggaga gcgaacactg gttgagcgcg tgtcgcctgg aaacgagggg      2100
     atcgacactc tcgtcaatat cgaagttatc cagtttcaag acgactttct ctacctgtag      2160
//

If you have problems or comments...

PBIL Back to PBIL home page