(data stored in ACNUC7421 zone)

EMBL: CP000031.PE355

CP000031.PE355       Location/Qualifiers
FT   CDS_pept        377206..378387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0364"
FT                   /product="decarboxylase, pyridoxal-dependent"
FT                   /note="identified by match to protein family HMM PF00278;
FT                   match to protein family HMM PF02784"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93682"
FT                   /db_xref="GOA:Q5LXE4"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002433"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXE4"
FT                   /protein_id="AAV93682.1"
FT                   /translation="MEMTLNAVVTGPLACESATLSRAETFILANRFDRPTLVIDTQAVA
FT                   RQFAALAQGLGRAGIHYAVKANPLPEILSTLARLGSNFDAASRVEIELCLAAGASADRI
FT                   SFGNTVKKPADIAWAHAAGIALFAADAEDELDKIAAHAPGAKVYIRMIVEACQADWPLS
FT                   RKFGCAPDKAIAVLDYARSVGLDPVGLSFHVGSQTRRAEMWVPVLDQVAAVWHAARAAG
FT                   HDLSLLNIGGGFPAFYGQEVDAPELYAAEVIRLVGERFGDVGQIMAEPGRGMVAEAGAI
FT                   AAEVLLVSRKSGHDLHRWVYLDIGKFSGLAETMDEAIRYQFLTEREHEPTGPCILAGPS
FT                   CDSADVLYEKKPVQLPLGLRDGDRIVIRNCGAYTSTYASVGFNGFPPLDVVAI"
     ttggagatga ccttgaacgc agttgtaacc gggcccttgg cctgcgaaag cgcgactctg        60
     tcccgcgccg aaacctttat tctggccaat cgtttcgatc gccccacgct ggtgattgac       120
     acccaggccg tcgcccgcca gttcgccgcg ctggcgcagg ggcttggccg cgcgggtatc       180
     cactatgcgg tcaaggcgaa cccgctgccg gaaatcctgt cgacgctggc tcgcttgggc       240
     agcaacttcg acgccgcctc gcgcgtcgag atcgagctgt gcctggccgc aggtgcctcg       300
     gctgaccgta tttcctttgg caacacggtc aagaaaccgg ccgatatcgc ctgggcgcat       360
     gccgccggga tcgcgctatt tgccgccgat gccgaagacg agttggacaa gatcgcagcc       420
     catgcaccgg gcgcaaaggt ctatatccgc atgatcgtcg aggcctgtca ggccgactgg       480
     ccgctcagcc gcaaattcgg ttgcgcgcct gacaaggcca tcgctgtcct cgactatgcg       540
     cgctctgtcg gtctcgaccc ggttggcctg tcctttcatg tgggctcgca aacccggcgc       600
     gccgagatgt gggttccggt tctggatcag gtggccgctg tctggcacgc tgcccgcgca       660
     gcagggcatg atctgagcct gctgaatatc ggcggtggct tcccggcctt ctatggtcag       720
     gaagtggatg cgcccgaact ctacgccgcc gaggtgatcc gcctggtggg cgagcggttt       780
     ggtgatgtgg ggcagatcat ggccgagccg ggccgcggca tggtggccga ggctggtgcg       840
     atcgcggccg aggttctgct cgtctcgcgc aaatccggcc atgacctgca ccgctgggtc       900
     tatctggata tcggcaaatt ctcgggcctg gccgaaacca tggacgaagc gatccgctat       960
     cagtttctga ccgagcgtga gcatgagccg acaggcccct gcatcctggc tggtccctcc      1020
     tgcgatagcg ccgatgtgct ttatgaaaag aaaccggttc agctgccgct gggtctgcgc      1080
     gatggcgacc ggatcgtgat ccgcaattgc ggcgcctata cctcgaccta tgccagcgtc      1140
     ggcttcaacg gtttcccgcc acttgacgtt gtcgcgatct ga                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page