(data stored in ACNUC9435 zone)

EMBL: CP000031.PE356

CP000031.PE356       Location/Qualifiers
FT   CDS_pept        378468..379325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0365"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:G97525"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93683"
FT                   /db_xref="GOA:Q5LXE3"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="PDB:3DI4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXE3"
FT                   /protein_id="AAV93683.1"
FT                   /translation="MTDAPADAPLDADARRAVKPVICYPNDSLPRPDLALYRAARASAR
FT                   KTGEVLVPPREGRCFEVKAGQFFRISSVEGPQVGDLNLHNLHDLTERFFSGKTRALHGT
FT                   HVTTGERLWSNLPYLRPMATIIEDTLGWYGIDQYGGSVHDVIGTRCDPYTGNLLAGGHY
FT                   HHCCHSNLTRALADHTGLPLHEAEMLVHDVLNVFMCTGFTRDTGQYFMKASPVRPGDYL
FT                   EFFAEIDLLGNLSACPGGDCSSEHSSDTASCHPLLVEIFAPAEGMLGDWPSPSVNGYDR
FT                   SHGR"
     atgaccgatg cccccgccga tgcccctttg gatgccgatg cccgccgcgc cgtaaagccg        60
     gtgatctgtt atcccaacga cagtcttcca cgccccgacc tggctctcta tcgcgcagca       120
     cgcgcgtctg ctcgcaagac gggcgaggtg ctggtcccgc cccgtgaggg ccggtgtttc       180
     gaggtcaaag cgggccaatt ctttcgcatc agctcggtcg aagggccgca ggtgggtgat       240
     ctgaacctgc acaacctgca tgacctgacc gagcggttct tttcgggcaa gacgcgcgcc       300
     ttgcacggca cccatgtcac cacgggcgag cggctatggt cgaacctgcc ttacctgcgc       360
     ccgatggcga cgatcatcga ggatacgctg ggctggtacg ggatcgacca atatggcggc       420
     tcggttcatg atgtgatcgg cacccgctgc gacccctata ccggcaatct gctggcgggg       480
     gggcactatc atcattgctg ccattccaac ctgacccggg ccctggccga ccataccggc       540
     ctgccgctgc acgaggccga gatgctggtg catgacgtgt tgaacgtctt catgtgcacc       600
     ggtttcaccc gcgatacggg gcagtatttc atgaaggcct cgccagtgcg gccgggcgac       660
     tatctggagt tctttgccga gatcgacctg ttgggcaatc tcagcgcatg tccaggaggc       720
     gattgctcgt ccgagcattc ctcggatacg gcatcctgtc atccgctcct ggtggagatt       780
     ttcgcgccgg cagagggcat gctaggagat tggcccagtc cgtcggtcaa tggctatgat       840
     cgtagccacg ggcgttaa                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page