(data stored in ACNUC9435 zone)

EMBL: CP000031.PE359

CP000031.PE359       Location/Qualifiers
FT   CDS_pept        complement(380565..382565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0368"
FT                   /product="methylmalonyl-CoA mutase"
FT                   /EC_number="5.4.99.2"
FT                   /note="identified by similarity to SP:Q49115; match to
FT                   protein family HMM PF01642; match to protein family HMM
FT                   PF02310; match to protein family HMM TIGR00640; match to
FT                   protein family HMM TIGR00641"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93686"
FT                   /db_xref="GOA:Q5LXF8"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXF8"
FT                   /protein_id="AAV93686.1"
FT                   /translation="MSQMQKDRQTANPDRKADRPWLIRTYAGHSTAKASNTLYRNNLSK
FT                   GQTGLSVAFDLPTQTGYDSDHVLARGEVGKVGVPICHLGDMRVLFDQIPLEQMNTSMTI
FT                   NATAPWLLALYIAVAEEQGADVSKLQGTVQNDLIKEYLSRGTYVCPPKPSLKMIADVAE
FT                   YCYTNVPKWNPMNVCSYHLQEAGATPEQELAYALATAIAVLDELKPRVPAEDFPALCGR
FT                   ISFFVNAGIRFVTEMCKMRAFVDLWDEILESRYGVSDPKFRRFRYGVQVNSLGLTEQQP
FT                   ENNVYRILIEMLAVTLSKKARARAVQLPAWNEALGLPRPWDQQWSMRMQQILAYETDLL
FT                   EFGDLFDGNPVVDAKVEELKAGARAELANLDSMGGAVASIEYMKSRLVDSNAERLNRIE
FT                   RNETVVVGVNRWTEGEPSPLQTEDGGIMVVDPAVEQEQIARLESWRADRDDAAVAAALE
FT                   ALRAAARTGANVMEPSIAAARAGVTTGEWAEEMRKAYGTYRGPTGVSGSVSNKTEGLED
FT                   LRAAVDAASDKLGRRLKFLVGKPGLDGHSNGAEQIAFRARDCGMDISYDGIRLTPEELV
FT                   ASALDQQAHVVGLSILSGSHLPLVEEVMERMKKAGLAHIPVIVGGIIPDEDSQKLRAMG
FT                   VAKVYTPKDFELNGIMGDIVTLVSDTEIAAE"
     atgtcgcaga tgcaaaaaga ccgtcagact gcaaatcccg accgcaaggc ggaccgtccc        60
     tggctgatcc gcacctatgc cggccattcg accgccaagg cctcgaacac gctttatcgc       120
     aacaacctgt ccaagggtca gaccggcctg tcggtggctt tcgacctgcc gacccagacc       180
     ggatatgaca gcgaccacgt gctggcgcgc ggcgaggtgg gcaaggtcgg cgttcccatc       240
     tgccatctgg gcgacatgcg ggtactgttc gaccagattc cgctggaaca gatgaatacc       300
     tcgatgacga tcaacgccac cgccccatgg cttctggcgc tttacatcgc ggtggccgag       360
     gaacagggcg cggatgtctc gaaactgcaa ggcacggttc agaacgacct gatcaaggaa       420
     tacctgtcgc gcggcaccta tgtctgcccg ccgaaaccct cgctcaagat gatcgcggac       480
     gtggccgagt attgctatac caacgtgccg aaatggaacc cgatgaacgt gtgttcctat       540
     cacctgcaag aggcgggcgc gacaccggaa caggaactgg cctatgcgct ggccaccgcc       600
     atcgccgtgt tggacgagtt gaaaccgcgt gtcccggcag aggattttcc tgcgctctgc       660
     gggcgcatct ctttctttgt gaacgcgggc atccgttttg tcaccgagat gtgcaagatg       720
     cgcgcctttg tcgatctgtg ggacgagatc ctggaaagcc gctatggcgt cagcgatccg       780
     aaattccgcc gctttcgcta tggggtgcag gtgaactcgc tgggtctgac cgaacagcaa       840
     ccggaaaaca acgtctatcg catcctgatc gagatgctgg ccgtgaccct gtcgaaaaag       900
     gcccgcgcgc gcgccgtgca gctgcccgcc tggaacgagg cactgggcct gccgcgcccc       960
     tgggaccagc aatggtcgat gcggatgcag caaatcctgg cctatgaaac cgacctgctg      1020
     gagtttggcg acctcttcga tggcaacccg gtcgtggacg ccaaggtcga agagctgaag      1080
     gcgggcgcgc gggcagagct tgccaatctc gactcgatgg gcggggccgt agcctcgatc      1140
     gaatacatga aatcgcggct ggtggattcc aatgccgaac ggctgaaccg gatcgagcgt      1200
     aacgagaccg tggtggtcgg cgtcaaccgc tggaccgagg gcgaaccctc gcccctgcag      1260
     accgaggatg gcggcatcat ggtcgtcgat ccggcggttg agcaggaaca gatcgcgcgg      1320
     ctggagagct ggcgcgccga tcgcgacgat gcggcggtgg cggcggcgct ggaggcgctg      1380
     cgcgccgccg cccggaccgg agcgaatgtg atggaacctt cgatcgcggc ggcccgggcc      1440
     ggtgtcacca ccggcgaatg ggccgaagag atgcgcaagg cctatggcac ctatcgcggc      1500
     cccaccggtg tatccggatc ggtttcgaac aagaccgaag gcctggaaga cctgcgcgcc      1560
     gcagtcgacg cggccagcga caagctgggg cggcggttga aattccttgt cggcaagccc      1620
     ggtctggacg gccattccaa cggcgccgag caaattgctt tccgcgcccg cgactgtggc      1680
     atggatatca gctatgacgg gatccgcctg acccccgagg agctggtcgc ctcggccctg      1740
     gaccagcaag cccatgttgt cggcctgtcg atcctgtctg gcagccatct gccgctggtc      1800
     gaagaggtga tggagcggat gaagaaggcc gggctcgcgc atattcccgt gatcgttggt      1860
     ggcattattc ccgatgaaga ttctcaaaaa ctgcgcgcaa tgggcgtcgc taaagtctat      1920
     acccccaagg atttcgaatt gaatggaata atgggcgata ttgtgacgct agtcagcgac      1980
     acagaaatag cggcggaata a                                                2001
//

If you have problems or comments...

PBIL Back to PBIL home page