(data stored in ACNUC7421 zone)

EMBL: CP000031.PE360

CP000031.PE360       Location/Qualifiers
FT   CDS_pept        382532..384115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0369"
FT                   /product="acyltransferase family protein"
FT                   /note="identified by similarity to SP:P00482; match to
FT                   protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93687"
FT                   /db_xref="GOA:Q5LXF7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXF7"
FT                   /protein_id="AAV93687.1"
FT                   /translation="MQSDGLFASATWTALRFWFGNKVSLEGSKSQFSGHVNSLHRGNHR
FT                   AHQTIVRPRIWWQGAGMTQTVELPLWLFVLIVLFAAVTFASHFLFPSVRWFFRRRLERA
FT                   VARLNTRLARPIQPFKLARRHDMIQRLIYDPEVARAVRDQAQAEGIPEAVAFEQAQRYA
FT                   REIVPGFSAFAYFSFAIRLARFLSNALYRVRLRHVDAEALRAIDPEATVVFVMNHRSNM
FT                   DYVLVTYLAAEQSALSYAVGEWARVWPLSRLIRAMGAYFIRRKSRSDLYRKVLAAYVRH
FT                   ATDAGVTQAMFPEGGLSLSGGLGRPKLGLLKYIVDGAIPEGRDVVFVPVSINYDRVLED
FT                   TILTAAASRGERRFRARIGVITMWFLKQMWWRMTGRFHRFGYAAVSFGRPLSLSEFRVR
FT                   TKGDPTVPLARELMSRIGVVVPVLPVPLVAWLILRNGPMTRSALAAGFDKVLAALPHAH
FT                   IHMPRDDRHYAIEVGLRQLIERRIIVETDGRFGPGTERQDLLTYYAASIAHLMDGGAAY
FT                   AEELSAIAGS"
     ttgcagtctg acggtctttt tgcatctgcg acatggacgg cccttcgatt ctggttcggt        60
     aacaaagttt cgctagaagg ttctaaatcg caattttcgg gacatgtcaa ttcgctgcat       120
     cgcggcaatc accgggcgca tcagacgatt gtgaggcctc gcatttggtg gcagggtgcc       180
     ggaatgacgc agaccgtgga acttccgctt tggctctttg tgctgatcgt gctgtttgcc       240
     gcggtcacct tcgcctcgca tttcctgttc ccctcggtgc gctggttttt tcggcgcagg       300
     ctggagcgtg cagtcgcccg tttgaacacg cggctggcgc ggcccattca gccgttcaag       360
     ctggcccgcc gccatgacat gatccagcgg ctgatctacg atcccgaagt ggcgcgcgcc       420
     gtgcgcgacc aggcccaggc cgagggtatc cccgaggcgg tcgcgttcga gcaggcgcaa       480
     cgctatgccc gcgagatcgt tccgggcttc tcggcctttg cctatttcag ctttgccatc       540
     cgcctcgccc ggttcctgtc aaacgcgctc taccgggtcc ggctgcgcca tgtggatgcc       600
     gaagcgctgc gtgcgatcga ccccgaggcc acggttgtct ttgtgatgaa tcaccgcagc       660
     aacatggatt acgtgttggt cacctatctg gccgccgagc aatctgcgct cagctatgcg       720
     gtgggcgaat gggcgcgcgt gtggccgctt agccggttga tcagggcgat gggggcgtat       780
     ttcatccgcc gcaaatcgcg cagcgatctc taccgcaagg tgctggccgc ctatgtccgg       840
     catgcgaccg atgcgggtgt gacccaggcg atgtttcccg aaggcgggct cagcctgtcg       900
     ggcgggttgg ggcggcccaa gctgggattg ctgaaatata tcgtcgatgg cgcgattccc       960
     gaggggcgtg atgtcgtctt tgtgccggtg tcgatcaatt acgaccgggt gctcgaggat      1020
     acgatcctga cagctgccgc cagccggggc gagcgccggt ttagggcccg gatcggggtc      1080
     atcacgatgt ggtttctcaa acagatgtgg tggcggatga ccggccggtt ccatcgcttt      1140
     ggctatgccg cggtcagttt cggcaggccg ctgtcgctgt cggagttccg tgtccggacc      1200
     aagggcgatc caacggtgcc gctggcgcga gagctgatgt cgcggatcgg ggtggttgtc      1260
     ccggtgctgc cggtgccgct ggtggcctgg ctgatcctgc gcaacgggcc gatgacccgc      1320
     agcgcgctgg ccgcagggtt cgataaggtg cttgctgcgc tgccgcatgc ccatatccat      1380
     atgccgcgtg acgatcgtca ttatgcgatc gaggtgggtt tgcgccagct gatcgagcgc      1440
     cgcatcatcg tcgagaccga cggccggttc ggccccggga ccgaacggca ggatctgctg      1500
     acctattacg cggcctctat cgcgcatctg atggatggcg gtgctgcata tgcagaagaa      1560
     ctttctgcaa ttgcagggtc ataa                                             1584
//

If you have problems or comments...

PBIL Back to PBIL home page