(data stored in ACNUC7421 zone)

EMBL: CP000031.PE366

CP000031.PE366       Location/Qualifiers
FT   CDS_pept        complement(389848..390798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0375"
FT                   /product="membrane protein"
FT                   /note="identified by match to protein family HMM PF01925"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93693"
FT                   /db_xref="GOA:Q5LXG6"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXG6"
FT                   /protein_id="AAV93693.1"
FT                   /translation="MAGHAGLTKNMQIYLPIAEVSVNAFLLLGLGGMVGILSGMFGVGG
FT                   GFLMTPLLFFIGIPPAVAVATEANQIVASSFSGVLAHFRRRTVDFRMGTILLIGGLSGA
FT                   ALGVVLFNYLKSLGQVDLLVKLCYVVFLGIIGGLMFIESLNAIRKSRKAGGAVPKRRQR
FT                   GWIHAMPFKMRFRTSGLYISVIPPIVVGLLVGVLSAIMGVGGGFIMVPAMIYLLGMPTK
FT                   VVVGTSLFQIIFVTAFTTMLHATTNYTVDVVLAVLLLVGGVIGAQIGTVIGARMKAEQL
FT                   RILLAGLVLAVCAKLALDLLLMPSELYSLGASGGH"
     ttggcggggc atgccggttt aacaaaaaac atgcagatat accttcccat tgccgaggtt        60
     tcggtcaacg cgttcctgct actgggcctc ggcggcatgg tcggcattct gtcgggcatg       120
     ttcggggtcg gtggcggatt tctgatgacg cccttgctgt tcttcatcgg catcccgccc       180
     gccgtggctg tggcaaccga agcgaaccag atcgtcgcct cgtccttttc gggggttctg       240
     gcccatttcc gaaggcgcac ggtcgatttc agaatgggaa cgatcctgct gatcggcggt       300
     ctgagcggtg cggcgctagg ggtggttctg ttcaactatc tcaagagcct gggccaggtc       360
     gatctgctgg tgaagctctg ttatgtcgtc tttctgggca tcatcggcgg gctgatgttc       420
     atcgaaagcc tgaatgcaat ccgcaaatcg cgcaaggcag gcggcgcggt ccccaagcga       480
     cgccagcgtg gctggatcca tgcgatgccg ttcaagatgc ggttccgcac ctcgggcctt       540
     tatatctcgg tcatcccgcc gatcgtggtc ggtctgctgg tgggcgtgct gtcggcgatc       600
     atgggggtcg gcggtggctt tatcatggtg cccgcgatga tctatctgct gggcatgccg       660
     accaaggtgg tggtcggcac ctcgctgttc cagatcatct tcgtgaccgc gtttaccacc       720
     atgctgcatg ccaccaccaa ctatacggtg gatgtggtgc tggcagtcct gctgctggtt       780
     ggcggcgtca tcggcgcgca gatcggcacg gtgatcggtg cccggatgaa ggcggagcaa       840
     ctgcgcatcc tgctggccgg gctggtgctg gcggtctgtg cgaaactggc tctcgacctg       900
     ttgctgatgc ccagcgagct ttactcgctt ggcgcctcag gggggcattg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page