(data stored in ACNUC7421 zone)

EMBL: CP000031.PE367

CP000031.PE367       Location/Qualifiers
FT   CDS_pept        complement(390860..391828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0376"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93694"
FT                   /db_xref="GOA:Q5LXG5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXG5"
FT                   /protein_id="AAV93694.1"
FT                   /translation="MMDFLTIIQVLDSTIRLSTPLLLACLAGLYSERAGIFDIGLEGKM
FT                   LMAAFFSAAVAAVSGSVWLGLLAGIASSLVLAGLHGLASITFRGNQLISGVAINFLAAG
FT                   MTVLVAQDWFKQGGRTPSLFGGARFEPIDWPLAETLSGIPVLGPIYAELLSGHSVLVYL
FT                   AFLAVPGTWWLLYRTRFGLRLRAVGENPAAVDTAGVSVVGLRYAAVMICGVLCGIAGAY
FT                   LATALQAGFVKDMTAGRGFIALAALIFAKWRPLHAMWACLLFGLLQAVALRFQNIDLGG
FT                   VVIPVQVMDALPYILTVVILAGFVGKAIPPRAGGEPYVKER"
     gtgatggatt tcctgacgat catccaggta ctcgactcga cgatccgcct gtcaacgccg        60
     ctgttgctgg cctgtctggc cgggctctat tccgaacggg cgggcatttt cgacatcggc       120
     cttgagggca agatgctgat ggccgcgttc ttttccgccg ccgtcgccgc ggtcagcggt       180
     tcggtctggc tgggccttct tgccgggatc gcctcgtctc tggtgctggc agggctgcat       240
     gggctggcct cgatcacctt tcgcggcaac cagctgattt ccggggtcgc gatcaacttc       300
     ctcgccgccg gcatgaccgt tctggtggcc caggactggt tcaagcaggg cgggcgcaca       360
     ccctcgctgt tcgggggcgc ccggttcgag ccgatcgact ggccgctggc cgagacgctg       420
     agcggcatcc ccgtgctggg gccgatctat gccgaactgc tgtcgggcca ttcggtgctg       480
     gtctatctcg cctttctggc ggtcccgggg acctggtggc tgctctaccg cacccggttc       540
     ggcctgcgcc tgcgcgccgt gggcgagaac ccggccgcgg tcgataccgc cggtgtctcg       600
     gtcgtcgggc tgcgctatgc ggcggtgatg atctgcggcg tgctgtgcgg cattgccggc       660
     gcctatctgg ccaccgcact gcaggccggg ttcgtcaagg acatgacggc cggacgcggc       720
     tttatcgcgc tggcggcgct gatctttgcc aaatggcgcc cgctgcatgc catgtgggcc       780
     tgtcttctgt tcggactgct tcaggcggtc gcgctcagat tccagaacat cgaccttggc       840
     ggtgtggtga ttccggtgca ggtcatggac gccctgccct atatcctgac ggtcgtgatt       900
     ctggcgggat tcgtcggcaa ggcgattccc ccgcgcgcag ggggtgaacc ctatgtgaaa       960
     gagcggtga                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page