(data stored in ACNUC9435 zone)

EMBL: CP000031.PE368

CP000031.PE368       Location/Qualifiers
FT   CDS_pept        complement(391825..392919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0377"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93695"
FT                   /db_xref="GOA:Q5LXG4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXG4"
FT                   /protein_id="AAV93695.1"
FT                   /translation="MDKMPKWADVVLIPLISLILAAILSALVILGIGEDPVAAVNMMVS
FT                   GALGSTYGWGYTLYYATNFMFTGLAVAVAFHARLFNIGGEGQAMLGGLGVAMICLYIPW
FT                   PHWTMALLAACAASMLFGAVWAAIPAYLQARRGSHIVITTIMFNFIAAALLNYMLVNVM
FT                   RPDGSMDPASERFPAAVHLPTLHELLAPIGISFSKAAPANVSLLVAVLACVVVWALIWR
FT                   TRLGYEIRAYGHSESGALYAGISPFKITMVAMLISGALAGLMATNNVMGEAERLVLNST
FT                   EGAGFIGIAVALMGRSHPFGVFLAAILFGFLYQGGAELALWTNIPRELIVVIQALVILF
FT                   TGALDNMVRMPLEKVFLALRKGNA"
     atggacaaga tgcccaaatg ggccgatgtg gtgctgatcc cgctgatcag cctgatcctg        60
     gccgcgatcc tgtcggcact ggtgatcctt ggtatcggtg aggatccggt ggccgccgtc       120
     aacatgatgg tatcgggggc gctggggtcg acctatggct ggggctatac gctctattac       180
     gccaccaatt tcatgttcac cggcctggcc gtggccgtcg cctttcatgc ccgcctgttc       240
     aacatcggcg gcgaggggca ggcaatgctg ggcgggcttg gcgtggcgat gatttgcctc       300
     tacatccctt ggccgcactg gaccatggcg ctgcttgccg cctgtgcggc ctcgatgctg       360
     ttcggggctg tctgggccgc catcccggcc tatctgcaag cgcgccgggg cagccatatc       420
     gtgatcacca ccatcatgtt caacttcatc gctgcggcct tgctgaacta tatgctggtc       480
     aacgtgatgc ggcccgacgg ctcgatggac ccggcaagcg aacgctttcc ggccgccgtg       540
     catctgccca ccctgcatga gctgctggcc ccgatcggca tcagcttttc caaggcggcg       600
     ccggcgaatg tgtcgctgct ggtggcggtg ctggcctgtg tcgtggtctg ggcgctgatc       660
     tggcgcaccc ggctgggata tgaaatccgc gcctatggcc attccgaatc cggcgcgctt       720
     tatgccggga tctcgccctt caagatcacc atggtcgcca tgctgatctc gggcgcgctg       780
     gccgggctca tggccaccaa caacgtgatg ggcgaggccg agcggctggt cctgaactcg       840
     accgagggcg cgggtttcat cgggatcgcc gtggcgctga tggggcgcag ccatccgttc       900
     ggggtgtttc tggccgcgat cctgttcggc tttctctatc agggcggcgc tgaactggcg       960
     ctgtggacca atatcccgcg cgagctgatc gtggtgatcc aggcgctggt gatcctgttt      1020
     accggggcgc tggacaacat ggtgcggatg ccgctggaga aagtcttcct ggccctgcgg      1080
     aaaggcaacg cgtga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page