(data stored in ACNUC7421 zone)

EMBL: CP000031.PE369

CP000031.PE369       Location/Qualifiers
FT   CDS_pept        complement(392919..394448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0378"
FT                   /product="sugar ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93696"
FT                   /db_xref="GOA:Q5LXG3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXG3"
FT                   /protein_id="AAV93696.1"
FT                   /translation="MTVPAIELKGISKSFGPVQANKDISISVAPGTIHGIIGENGAGKS
FT                   TLMSILYGFYKADKGEIWINGKKTEIPDSQAAIAAGIGMVFQHFKLVENFTVLENIILG
FT                   AEDGGLLKPSLAKARRTLAELAAEYELNVDPDAVIEEIGVGMQQRVEILKALYRQAEIL
FT                   ILDEPTGVLTPAEADQLFRILHRLKDEGKTIILITHKLREIMEATDTVSVMRRGEMTAT
FT                   VKTAETSPEHLAELMVGRKVLLRVDKVPAKPGKPILEIENLRVTDEKGVERVKGIDLTV
FT                   RAGEILGIAGVAGNGQSELLEVLGGMRPGSGAIRLNGAPLPLSGPGSDARARRTAHVAH
FT                   VPEDRQREGLIMDFHAWENVAFGYHHDPAYQSGIFMNNAALRADTERKIEKFDVRPADG
FT                   WLAAKNFSGGNQQKIVVAREIERNPDLLLVGQPTRGVDIGAIEFIHKQIVALRDQGKAV
FT                   LLVSVELEEIFGLADRIAVMFDGHIMGERLPDETDEKELGLLMAGVNGEAA"
     atgaccgtcc ccgccatcga gctcaaaggg atttccaaat cctttgggcc tgtgcaagca        60
     aacaaggaca tctcgatcag cgtcgccccc ggcaccattc acggtatcat cggcgaaaac       120
     ggtgcgggca agtccaccct gatgagcatc ctttacggct tctacaaggc cgacaagggc       180
     gagatatgga tcaacggcaa gaagaccgag atcccagaca gccaggcggc cattgccgcc       240
     gggatcggca tggtgttcca gcatttcaag ctggtcgaga attttaccgt gctggaaaac       300
     atcattctgg gcgccgagga tggcgggttg ctgaaaccct cgctggccaa ggcccgccgc       360
     accctggccg agctggccgc cgaatacgag ctgaatgtcg accccgatgc ggtgatcgaa       420
     gagatcggcg tcggcatgca acagcgggtc gagatcctca aggcgctgta tcggcaggcc       480
     gaaatcctga tcctggacga gccgaccggc gtgctgaccc cggctgaggc cgatcagctg       540
     ttccgcatcc ttcaccggct caaggacgag ggcaagacga tcatcctgat cacccacaag       600
     ctgcgcgaga tcatggaggc gactgacacg gtcagcgtca tgcggcgggg cgagatgacg       660
     gccaccgtca agaccgccga aaccagcccc gaacatctgg ccgagttgat ggtgggccgc       720
     aaggtgctgc tgcgcgtcga caaggtgccc gccaaacccg gaaaaccgat cctggagatc       780
     gagaacctgc gcgtaaccga cgaaaagggc gtcgaacgtg tcaagggcat cgacctgacc       840
     gtgcgcgcgg gcgagatcct gggcatcgcc ggcgttgccg gaaatggcca gtccgaactg       900
     ctcgaggttc tgggcggcat gcgcccgggc agcggcgcga tccggctgaa cggcgctccg       960
     ctgccgctga gcggacccgg atccgacgcg cgcgcccgcc gcaccgccca tgtggcccat      1020
     gtgcccgagg atcgccagcg tgaaggtctg atcatggact tccacgcctg ggaaaacgtc      1080
     gcctttggct atcaccacga tccggcctat caatccggca tcttcatgaa caacgccgcc      1140
     ctgcgcgccg ataccgagcg caagatcgag aaattcgatg tccgccccgc cgatggttgg      1200
     ctggcagcca agaatttctc gggcggcaac cagcaaaaga tcgtcgtggc acgcgagatc      1260
     gagcgcaatc ctgacctgct gctggtcggc caaccgacac gcggcgtcga tatcggcgcc      1320
     atcgagttca ttcacaagca gatcgtcgcc ctgcgcgatc agggcaaggc ggtgctgctg      1380
     gtctcggtcg agctggagga gatctttggc ctcgccgacc ggattgcggt gatgttcgac      1440
     ggccatatca tgggcgaacg cctgcccgac gagacggatg aaaaggaact tggcctcttg      1500
     atggccggtg tcaacgggga ggccgcctga                                       1530
//

If you have problems or comments...

PBIL Back to PBIL home page