(data stored in ACNUC7421 zone)

EMBL: CP000031.PE370

CP000031.PE370       Location/Qualifiers
FT   CDS_pept        complement(394572..395570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0379"
FT                   /product="sugar ABC transporter, periplasmic sugar-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02608"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93697"
FT                   /db_xref="GOA:Q5LXG2"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXG2"
FT                   /protein_id="AAV93697.1"
FT                   /translation="MTLMKSLMGAAAAMALTAGAALAEPALIFDLGGKFDKSFNEAAFN
FT                   GAQRWAEETGGSFREIELQSEAQREQALRRFAEAGANPVITMGFAMADPLSAVAADYPD
FT                   TKFVAVDVTWLDAPNIRQIGFAEHEGSYLVGMMAAMASKSGTVGFVGGMDIPLIRHFGC
FT                   GYAQGVKAVNPDVKIVANMTGTTPAAWNDPVKGSELTKAQISQGADVVYAAAGGTGVGV
FT                   LQTAADEGILSIGVDSNQNHLHPGKVLTSMLKRVDVAVYDAMKAGENLETGVFNMGLAE
FT                   EGVGYALDDNNAALISGEMKAAVDQARQDIIDGKLNVVSYYENDSCPALKF"
     atgaccctga tgaaatccct gatgggagcc gccgccgcga tggcgctgac cgcgggcgcc        60
     gccctggccg aaccggccct gatctttgat ctgggcggca agttcgacaa gtcgttcaac       120
     gaggccgcat tcaacggcgc gcagcgctgg gccgaggaaa ccggcggcag cttccgcgag       180
     atcgagctgc aatcggaagc ccagcgcgag caggccctgc gccgctttgc cgaggcgggc       240
     gccaacccgg tcatcaccat gggcttcgcc atggccgacc cgctgagcgc cgtggccgca       300
     gactatcccg acaccaagtt cgtcgcggtg gacgtgacct ggcttgacgc gcccaatatc       360
     cgccagatcg gctttgccga acacgaaggc tcgtatctgg tcggcatgat ggcggcgatg       420
     gcctcgaagt cgggcaccgt gggctttgtt ggcggcatgg acattccgct gatccgccac       480
     tttggctgcg gctatgcgca gggcgtcaag gcggtgaacc ccgatgtcaa gatcgtggcc       540
     aacatgaccg gcacgacgcc ggctgcctgg aacgacccgg tgaaggggtc ggagctgacc       600
     aaggcgcaga tcagccaggg cgctgacgtg gtctatgccg cggctggcgg caccggtgtc       660
     ggcgtgctgc agaccgccgc tgacgaaggc atcctgtcga tcggcgtcga cagcaaccag       720
     aaccacctgc atccgggcaa ggtgctgacc tcgatgctga aacgcgtcga cgtggccgtc       780
     tatgacgcga tgaaggccgg cgaaaatctg gaaaccggcg tcttcaacat gggcctcgcc       840
     gaagagggcg tgggctatgc gctggatgac aacaacgccg ccctgatctc gggagagatg       900
     aaggccgcgg tcgatcaggc ccgtcaggac atcattgacg gcaagctgaa cgtcgtgagc       960
     tattacgaga acgacagctg ccccgcactg aagttctga                              999
//

If you have problems or comments...

PBIL Back to PBIL home page