(data stored in ACNUC7421 zone)

EMBL: CP000031.PE372

CP000031.PE372       Location/Qualifiers
FT   CDS_pept        complement(396139..396729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0381"
FT                   /product="protease, putative"
FT                   /note="identified by match to protein family HMM PF00814"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93699"
FT                   /db_xref="GOA:Q5LXH1"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXH1"
FT                   /protein_id="AAV93699.1"
FT                   /translation="MPSDPVILAFDTSAAHCAAALLVGDRIVAATAEEMTRGQAERLMP
FT                   LLEEVLAGAGLGWHDLDAIGVGIGPGNFTGIRISVSAARGLALGLGIPAVGVDGFEARA
FT                   LLTPLGVHPAIPAPRDHVYLAPDGGTPQLLPRDQAEALGPLQAEYSPQGLAEAIARAAA
FT                   PRWRDATIPPAPLYVRPADAAPSRDRPPVLLDP"
     ttgccgtctg acccggtcat tctggcattc gacacatcgg ccgcgcattg cgcggccgct        60
     ttgctggtgg gtgaccggat cgtcgccgcc accgccgaag agatgacgcg cggccaggcc       120
     gagcggctga tgccgctgct tgaagaggta ctggccgggg ctggcttggg ctggcacgat       180
     ctcgacgcca tcggcgtcgg aatcgggccg ggcaatttca ccggcatccg gatttccgtc       240
     tcggccgcgc gcgggctggc actggggctt ggtatccctg cagtcggcgt ggacgggttc       300
     gaggcccgcg cgctgctgac gccgctgggc gtccacccgg cgatccccgc gccccgcgat       360
     cacgtctacc tcgcccccga tggcggcacc ccgcagctgt tgccacggga tcaggcagag       420
     gcgcttggcc cgcttcaggc cgagtacagc ccgcaagggc tggccgaggc catcgcccgt       480
     gccgccgccc cgcgctggcg cgatgccacc atcccgccgg ccccgcttta tgtccgcccg       540
     gcagatgcgg cgccatcgcg tgaccggccg ccagtgctgc tggacccatg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page