(data stored in ACNUC7421 zone)

EMBL: CP000031.PE373

CP000031.PE373       Location/Qualifiers
FT   CDS_pept        complement(396719..397282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0382"
FT                   /product="nifU domain protein"
FT                   /note="identified by match to protein family HMM PF01106"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93700"
FT                   /db_xref="GOA:Q5LXH0"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXH0"
FT                   /protein_id="AAV93700.1"
FT                   /translation="MFIQTESTPNPATLKFLPGQTVLEVGTADFPSAEAAEKSPLAARI
FT                   FAVSGVTGVFFGNDFVTVTKAEGVEWDHIKPAILGAVMEHYQSGQPVMGADAQTGSGHA
FT                   EHSGEDAEVVTQIKALLDSRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLT
FT                   LKMGIENLLRHYIPEVTEVRPVAV"
     atgttcatcc agaccgaatc gaccccgaac ccggcaacgc tgaaattcct gcccggacaa        60
     accgttctgg aggtgggcac tgccgatttc ccctcggccg aagcggccga gaaatcgccg       120
     ctggccgccc gtatctttgc cgtctccggg gtgaccggtg tgttcttcgg caatgatttc       180
     gtgaccgtga ccaaggccga aggcgtcgaa tgggatcata tcaaacccgc gatcctgggc       240
     gccgtgatgg agcattatca gtcgggccag ccggtgatgg gcgccgatgc gcagaccggg       300
     tcgggccatg ccgaacacag cggcgaggat gccgaggtgg tgacccagat caaggcgctg       360
     ctggatagcc gggtacgccc ggcggtggct caggatggcg gcgacatcac ctttcacggg       420
     tttgaccggg gtgtggtcta tctgcatatg cagggcgcct gcgcgggctg tccgtcttcg       480
     accctgaccc tgaaaatggg gatcgagaat ctgctgcgcc actacatccc cgaagtgacc       540
     gaggtccgcc ccgttgccgt ctga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page