(data stored in ACNUC7421 zone)

EMBL: CP000031.PE374

CP000031.PE374       Location/Qualifiers
FT   CDS_pept        complement(397406..398020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0383"
FT                   /product="acyl carrier protein phosphodiesterase, putative"
FT                   /note="identified by similarity to SP:P41407; match to
FT                   protein family HMM PF02525"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93701"
FT                   /db_xref="GOA:Q5LXG9"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LXG9"
FT                   /protein_id="AAV93701.1"
FT                   /translation="MTKLLQIIASPRGGDSKSNALADAFVAAQRAKDSTLQVDHLDLWA
FT                   EDLPAFDGDPAAAKMTFFGVGQMDPSKEQAWSAVARITERFMSADHVVMGVPMWNGGIP
FT                   YRLKHYIDIITQPGMLFGFDPDNGYSGLLRNRKATVVTTSGVWSEGADARFGSDFHSTY
FT                   LKWWFETIGITDVTFVRYQPSLLTDDPQAGYDRALAALTAA"
     atgaccaaac tccttcaaat catcgcctcg ccgcgcggcg gcgactcgaa atcgaatgcc        60
     cttgccgacg cctttgtcgc cgcgcaacgc gccaaggaca gcacgcttca ggtggatcac       120
     ctggaccttt gggcggaaga cctgccggca tttgacggcg acccggccgc cgccaagatg       180
     accttcttcg gggtcggtca gatggacccc tccaaggaac aggcatggtc ggcggtcgca       240
     aggatcaccg agcgtttcat gtccgccgat catgttgtga tgggcgttcc gatgtggaac       300
     ggcgggatcc cctatcgcct gaaacattat atcgacatca ttacccagcc cggaatgctg       360
     ttcgggttcg accccgacaa cggctattcc ggcctgttga ggaacaggaa ggcaactgtg       420
     gtgacgacaa gcggcgtctg gtccgagggg gcggatgcca gatttggcag cgattttcac       480
     tcgacctatc tgaaatggtg gttcgagacg atcggaatca cggatgtcac ctttgtcaga       540
     taccagcctt cgctgctgac ggacgatcct caggcagggt atgaccgggc gctcgccgcc       600
     ctgactgccg cctga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page