(data stored in ACNUC7421 zone)

EMBL: CP000031.PE375

CP000031.PE375       Location/Qualifiers
FT   CDS_pept        398149..398739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0384"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:BAC89223.1; match to
FT                   protein family HMM PF07336"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93702"
FT                   /db_xref="GOA:Q5LXG8"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXG8"
FT                   /protein_id="AAV93702.1"
FT                   /translation="MQTALPPPYLIADDPGLELLNSTGAPYGTEIDWLQNGTEMLAWMQ
FT                   AVGLLGATEAELVRSTLGARELDAAASDLRDLRAMFRENVPVASAGFVDRLNACLAETS
FT                   GHARIVMTEAGTQELQHVQRFRTGRDLVGLCALAIAELLSQGESGRTRQCGGPTCTYWF
FT                   RDVSKNNRRRWCSMAVCGNRAKVATHRARARSE"
     atgcaaaccg ctcttccacc gccttacttg attgccgacg atccggggct cgagttgctg        60
     aactcgaccg gggcacccta tggcaccgaa atcgactggt tgcagaacgg caccgagatg       120
     ctggcctgga tgcaggcggt cggcttgctg ggcgccacag aggccgagtt ggttcgcagc       180
     acgcttggcg cgcgggaact ggatgccgcc gcatccgacc tacgggattt gcgggcgatg       240
     tttcgagaga acgtgccggt ggcctcggcc gggtttgtcg atcgcctgaa cgcctgtctt       300
     gcggaaacca gtgggcatgc ccgtatcgtc atgaccgagg cgggcacgca agagctgcag       360
     catgtgcaaa ggtttcgaac cggtcgtgat ctggtcggtc tatgtgccct cgccatcgcc       420
     gaactgttga gccagggcga gtccggtcgg acccggcagt gtggcggacc tacctgtacc       480
     tattggttcc gcgatgtcag caagaacaac cgccgcaggt ggtgcagcat ggcggtttgc       540
     ggcaatcggg ccaaggtggc aacgcatcgc gcccgcgcca gatcggagtg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page