(data stored in ACNUC7421 zone)

EMBL: CP000031.PE376

CP000031.PE376       Location/Qualifiers
FT   CDS_pept        complement(398793..399386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0385"
FT                   /product="2-hydroxychromene-2-carboxylate isomerase,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF01323"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93703"
FT                   /db_xref="GOA:Q5LXG7"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXG7"
FT                   /protein_id="AAV93703.1"
FT                   /translation="MGKRIAFWFEFASTYSYLSAMRIERAAADLGVTIAWEPFLLGPIF
FT                   AAQGWTSSPFNLFPAKGRYMWRDMERLCARQGLPLTRPDPFPQNGLPAARLAMVAREMG
FT                   HIAPFVRAVYAAQFGRGLVISDPQVLAECWAEAGLPPEAMEQAKSPEIKAALFAQGERA
FT                   AALDLFGAPSFVVGEEVFWGDDRLDQALALAAQS"
     atgggcaagc gcatcgcatt ctggttcgaa ttcgcctcga cctattccta tctctcggcg        60
     atgcggatcg agcgggccgc cgccgatctg ggggtgacca tcgcatggga gcccttcttg       120
     ctggggccga tctttgcggc acagggctgg accagctcgc ccttcaacct ctttccggcc       180
     aaggggcgat acatgtggcg cgatatggag cggctttgcg cccggcaggg cctgccgttg       240
     acgcggcccg acccgttccc gcaaaacggg cttccggcgg cgcggctggc gatggtagcg       300
     cgcgaaatgg gccacatcgc accctttgtc cgcgccgttt atgctgcgca gttcggacgt       360
     gggctggtga tatcggaccc gcaagtgctg gccgagtgct gggccgaggc cgggctgccg       420
     cccgaggcca tggagcaggc caaatcgccc gagatcaaag ccgcgctgtt tgcgcagggc       480
     gaacgcgccg ccgcgctcga cctgttcgga gcccccagtt tcgtggtcgg agaggaagtg       540
     ttctggggtg acgaccggct ggatcaggca ttggcgctgg cggcccagtc ctga             594
//

If you have problems or comments...

PBIL Back to PBIL home page