(data stored in ACNUC9435 zone)

EMBL: CP000031.PE378

CP000031.PE378       Location/Qualifiers
FT   CDS_pept        complement(399889..400953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0387"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93705"
FT                   /db_xref="GOA:Q5LXH6"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXH6"
FT                   /protein_id="AAV93705.1"
FT                   /translation="MIAQIGDPRRDLLTLAVGALGALIATLVHMPMALLAGPAVAVSLA
FT                   GLCGLSLHISPRLRDAGFLVIGLSIGSLVGPESIEAMMRWPVAFGLLAGLTLATPWAGR
FT                   WLIPRLLPIDRDEAFLAAAPGHLSLVIALADSLQLSLTRPVVLASIRLMALTLLVPLAA
FT                   SLAGIEIGPGLPQLAAVTPWAWILGQIVAALLLAPVLKALKLPAHVLIAGIVVAATTHL
FT                   AGWTAGGLPGWAAQASLILMGAMIGSRFGGMGWRELRQSLTAGLAIVVLTTGLATLAAL
FT                   PAAYLSGLPLLDVLLGFSPGGLETMIILSAALGADPSFVAAAHLFRLSVLAVVLTLYAT
FT                   DVARRGQGKSDGQR"
     gtgatcgcgc agatcggcga tccgcgccgg gacctgctga cgctggcggt cggcgccctt        60
     ggcgccctga tcgcgaccct cgtgcacatg ccgatggcgc tgctggccgg ccccgccgtc       120
     gcggtatcgt tggcagggct ttgcggtctt tcgcttcata tttcgccgcg tttgcgcgac       180
     gcgggcttcc tggtcatcgg gctcagcatc ggatcgctgg tggggcccga aagcatcgag       240
     gcgatgatgc gctggccggt agcctttggg ctgctggccg ggctgaccct ggccaccccc       300
     tgggccgggc gctggctgat cccgcgcctg ctgcccatcg accgggacga ggcgtttctg       360
     gccgcggccc ccgggcatct gagccttgtc atcgccctgg ccgacagcct gcaactgtcg       420
     ctgacccgcc cggtcgttct ggcctcgatc cggttgatgg cgctgacgct gctggtaccg       480
     ctggccgcat ccctggcggg gatcgagatc ggcccgggcc tgccccagct cgcggccgtg       540
     acgccctggg cctggatcct tggccagatt gtcgccgccc tgttgctggc cccggttctg       600
     aaagcgttga agctgcccgc ccatgtgctg atcgccggga tcgtggtggc ggcaaccacg       660
     catctggccg gctggaccgc cggcggcctg ccgggctggg ccgcgcaggc gtcgctgatc       720
     ctgatgggtg cgatgatcgg aagccggttt ggcggcatgg gctggcgcga gctgcgtcaa       780
     agcctgaccg ctggtcttgc catcgtcgtg ctgaccaccg ggctggcgac cctggcggcg       840
     ctgccggcgg cctatctttc cggtctgccg ctgctggatg tattgctggg gttttcgccg       900
     ggtggcctcg aaaccatgat cattctcagc gccgccctgg gcgccgatcc cagttttgtc       960
     gcggcggcgc atctgtttcg cctgtcggtg ctggcggttg tcctgaccct ctacgccacc      1020
     gatgtcgccc gacgggggca agggaaaagc gatggacagc gttag                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page