(data stored in ACNUC7421 zone)

EMBL: CP000031.PE379

CP000031.PE379       Location/Qualifiers
FT   CDS_pept        complement(400950..401813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0388"
FT                   /product="aminotransferase, class IV"
FT                   /note="identified by match to protein family HMM PF01063"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93706"
FT                   /db_xref="GOA:Q5LXH5"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXH5"
FT                   /protein_id="AAV93706.1"
FT                   /translation="MATGSNIRTYFQGSWHEGDAPIIRAADHGAWLGSGVFDGARYFDG
FT                   MAPDLEAHCARVNRSAEALMLTPTVSTQDMVEIVREGLKAYGPDQAVYIRPMYWGIDGD
FT                   PTAIIPQADSTGFAVCLEEIPMAPATASATLTTTRFRRPVLEDAVVNAKAGCLYPNNAR
FT                   MLREARSKGFTNALVADALGNVAETATANIFMVKDGEVFTPIANGTFLAGITRARHIKN
FT                   LRADGVPVHETVLSFADFHAADEVFMSGNMSKVTPVTALDDTQYQIGPIARRARALYWD
FT                   WAKSTA"
     atggcaaccg gcagcaatat ccgcacctat ttccaaggca gctggcacga gggcgatgcc        60
     ccgatcatcc gcgccgccga tcacggcgcc tggctgggat cgggcgtgtt cgacggcgcc       120
     cgctatttcg acgggatggc ccccgacctg gaggcccatt gcgcccgagt caaccgctcg       180
     gccgaggcgc tgatgctgac ccccacggta tcgacccaag acatggtcga gatcgtgcgc       240
     gaggggctca aggcctatgg gccggatcag gcagtctata tccggccgat gtactggggc       300
     atcgacgggg atccgaccgc gatcatcccg caggccgaca gcaccggttt cgccgtctgc       360
     ctggaagaga tcccgatggc ccccgccacg gcctcggcca cgctgacaac tacacggttc       420
     cgccgcccgg tgctcgagga tgcggtggtc aatgccaagg ccggatgcct gtaccccaac       480
     aacgcccgga tgctgcgaga ggcgcggtcg aaggggttca ccaacgcgct ggtggccgat       540
     gcgctgggca atgtggccga aaccgccacc gccaatatct tcatggtcaa ggatggcgag       600
     gtgttcacac cgatcgcaaa cggcaccttc ctggccggca tcacccgcgc gcggcatatc       660
     aagaacctgc gcgctgacgg tgttcccgtg cacgaaacgg tgctgagctt tgccgatttc       720
     cacgcagccg acgaggtgtt catgtccggc aacatgagca aggtgacccc ggttactgcg       780
     ctggacgaca cccagtacca gatcgggccg atcgcccggc gcgcgcgcgc gctttattgg       840
     gactgggcga aatccaccgc gtga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page