(data stored in ACNUC7421 zone)

EMBL: CP000031.PE380

CP000031.PE380       Location/Qualifiers
FT   CDS_pept        complement(401873..402334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0389"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93707"
FT                   /db_xref="GOA:Q5LXH4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXH4"
FT                   /protein_id="AAV93707.1"
FT                   /translation="MDQIDHRIVRALQRDGRMTISDLADKVGLSPTPCARRLERLQRDG
FT                   VITGYSARVDPAKLGLGVSVFVSVELERQERAAVDAFERAIRTCDEVMECYLMTGSRDI
FT                   LLRVLVADLAAFDAFLENRLMQIPGIRNLRSNFALRTMVQRDSLPAIRR"
     atggatcaga tcgaccaccg cattgtccgc gccctgcaac gcgacgggcg catgaccatc        60
     tcggatctgg cggacaaggt cgggctgtcg ccgaccccct gcgcccggcg gctggaacgg       120
     ttgcagcgtg acggcgtgat taccggttac agcgcccggg tcgacccggc caagctgggg       180
     ctgggcgtgt cggtctttgt ctcggtcgaa ctggagcggc aggaacgcgc cgccgtcgat       240
     gcattcgaac gggcgatccg cacctgtgac gaggtgatgg aatgctatct gatgaccggt       300
     tcgcgcgata tcctgctgcg ggttctggtg gccgatctgg cggcattcga tgcgttcctg       360
     gagaaccgac ttatgcagat ccccggcatc cgcaacctgc ggtccaactt cgccctgcgc       420
     accatggtcc agcgcgacag cctgcccgcg atccgccgct ag                          462
//

If you have problems or comments...

PBIL Back to PBIL home page