(data stored in ACNUC7421 zone)

EMBL: CP000031.PE381

CP000031.PE381       Location/Qualifiers
FT   CDS_pept        402464..403513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0390"
FT                   /product="glutamate/leucine/phenylalanine/valine
FT                   dehydrogenase family protein"
FT                   /note="identified by match to protein family HMM PF00208;
FT                   match to protein family HMM PF02812"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93708"
FT                   /db_xref="GOA:Q5LXH3"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR016211"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXH3"
FT                   /protein_id="AAV93708.1"
FT                   /translation="MQITPVAAPEHEQVVRIADPESGLLGFIAIHSTRRGPAAGGVRMR
FT                   PYAQEADALNDALRLSRGMTYKNAAAGLDLGGGKAVIMADPATQKTPDLLAAFGSAVET
FT                   LAGRYWTAEDMGMTPADMARIGTRTTCVAGLADGDFASGDPSPITARGIFYAIRTAAKH
FT                   RLGSVDLTGRTVAVQGLGHVGHYLCGYLHQAGANLIVTDIDRAQVARVAERYGATAVAP
FT                   DAIYGVEADIFAPCAIGAILNAETIPQLKVRVVAGGANNQLATPEDATRLHDLGILYAP
FT                   DYVANGGGIINVATEILKISGREAWVASRLAALDDTMDRILTRARILSVSPAEVADATV
FT                   DEILQAKAA"
     atgcagatta cacccgtcgc agcgcccgaa cacgaacagg tggtccgtat agcggaccct        60
     gaaagcgggc ttctgggctt tatcgccatc cactccaccc ggcgcggtcc cgctgcgggc       120
     ggcgtgcgga tgcgccccta tgcgcaagag gcagacgcgc tcaacgacgc gctgcgcctg       180
     tcgcgcggca tgacctataa gaatgccgcc gcgggcctcg atctgggcgg tggcaaggcg       240
     gtgatcatgg ccgatcccgc aacccagaag acgccggacc tgcttgccgc cttcggctct       300
     gcggtcgaga cgctggcggg ccgttactgg acggccgagg atatgggcat gacccccgcc       360
     gacatggcgc ggatcggcac ccgcaccacc tgtgttgcgg gtctggccga cggggatttc       420
     gccagtggcg acccctcgcc gatcaccgcg cgcggaattt tttacgcgat ccgcacggcg       480
     gcgaaacacc gtctgggttc cgtggacctg accggccgca ccgtcgcggt gcagggtctg       540
     ggccatgttg gtcactatct gtgcggctac ctgcatcagg ctggtgcaaa cctgatcgtg       600
     accgatatcg accgcgccca ggtggcccgc gtggcagagc gctacggtgc caccgccgtc       660
     gcgcccgacg cgatctacgg ggtcgaggcc gatatctttg cgccctgcgc catcggagcc       720
     atcctgaatg ccgagaccat cccgcagttg aaggtacggg tggtcgcagg tggtgcgaac       780
     aaccagttgg cgacgcccga ggatgccacc cgcctgcacg atctgggtat tctctacgcg       840
     cccgattacg tggccaatgg cggcggcatc atcaatgtgg cgaccgagat cctcaagatc       900
     tcggggcgcg aggcctgggt tgccagccgc ctggcggcgc tggacgacac catggaccgc       960
     atcctgaccc gcgcccgcat tctgtcggtc agccccgccg aggtggcgga tgccaccgtg      1020
     gatgagatcc tgcaggccaa ggccgcctga                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page