(data stored in ACNUC7421 zone)

EMBL: CP000031.PE384

CP000031.PE384       Location/Qualifiers
FT   CDS_pept        405115..405927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0393"
FT                   /product="rhomboid family protein"
FT                   /note="identified by match to protein family HMM PF01694"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93711"
FT                   /db_xref="GOA:Q5LWE9"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWE9"
FT                   /protein_id="AAV93711.1"
FT                   /translation="MPENTRGVNWVSVMMGNSRLENSVPVAYPWGKGTSTAAKGPPMSS
FT                   DNDTSPVNPLPPVVVALVLFIMGIEITFSLGARGIVGGPQAVGWRLAAMQSYAFSPDIL
FT                   TWMWETGRWPVEHVIRLVSYPFVSVSFTQSLFVCVFVLAMGKMVAESFGSLAMLVVFLV
FT                   SGIGGALGYALLTGSPVALIGGFPPVYGLIGAFTWLLWRKLSLVGQHQARAFSLIAFLM
FT                   GAQLLFGLLFGGGLDWVADLAGFATGFALSFLLSPGGWARMRGRIRHD"
     atgccggaaa acacacgcgg cgtgaactgg gtttcggtca tgatggggaa ctcccgtctg        60
     gaaaattcgg tccccgtcgc ttacccatgg ggcaaaggga cgtcaacagc cgcgaaaggc       120
     ccgcccatga gcagtgataa cgatacatcg ccggtcaatc cgctaccgcc cgttgtggtg       180
     gcgctggtgc tcttcatcat ggggatcgag atcacctttt ccctcggcgc acgcggcatt       240
     gtcggcgggc ctcaggcagt gggctggcga ctggcggcga tgcagtccta tgccttttcg       300
     cccgatatcc tgacctggat gtgggaaacc gggcgctggc ctgtcgaaca tgtgatccgt       360
     ctggtgagct atccgtttgt cagcgtctcg ttcacccaat cgctgtttgt ctgcgttttc       420
     gtactggcaa tgggcaagat ggtggccgag agctttggca gcctggcgat gctggtggta       480
     ttcctggttt cgggcatcgg aggggcgctg ggatatgcgc tgctgaccgg ttcgccggtg       540
     gcgctgatcg ggggctttcc acctgtctat gggctgatcg gggcctttac ctggctcttg       600
     tggcgcaagc tgtcgctggt ggggcagcat caggcgcggg cgttcagcct gatcgccttt       660
     ctgatggggg cgcaactgct gttcggcctg ctgtttggcg gcgggctgga ttgggtcgcc       720
     gatctggcgg gctttgccac cggatttgcg ctgtccttcc tgctgtcgcc gggcggctgg       780
     gcgcggatgc gcggccggat ccgccacgat tag                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page