(data stored in ACNUC7421 zone)

EMBL: CP000031.PE385

CP000031.PE385       Location/Qualifiers
FT   CDS_pept        complement(405948..406139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0394"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAE09894.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93712"
FT                   /db_xref="GOA:Q5LWE8"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWE8"
FT                   /protein_id="AAV93712.1"
FT                   /translation="MTRNEGTLDRAARIILGLVLLSLTVIGPKTMWGLVGLIPLLTGLV
FT                   GSCPLYTILGLNTCPLKK"
     atgacccgca acgaaggaac cctcgaccgt gccgcccgta tcattctggg cctggtcctg        60
     ttgtcgctga ccgtgatcgg ccccaagacc atgtggggtc tggttggcct gatcccgctt       120
     ttgaccgggc tggtggggtc ctgcccgctt tacaccatcc tgggcctgaa cacctgcccg       180
     ctgaagaaat aa                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page