(data stored in ACNUC9435 zone)

EMBL: CP000031.PE39

CP000031.PE39        Location/Qualifiers
FT   CDS_pept        40483..41304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0040"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93371"
FT                   /db_xref="GOA:Q5LWJ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWJ9"
FT                   /protein_id="AAV93371.1"
FT                   /translation="MFRYRQHKSLLSGAITMAELIFHNVVRGVRQGHSNAYAALGKNMM
FT                   QILVFVLVFYMMFSMLGLRGSAIRGDFLLYIMSGIFLFMVHIKTVGAVAGAEGPNSAMM
FT                   KHAPMNTIIAILSAALGSLYTQLLTLFLILFGYHVAFKPVEIADPAGAFGMLMLAWFTG
FT                   CAVGLVFLSIKPWAPMLVGVMTTLYQRANMIASGKMFVANTLPGYMLAMFDWNPLFHAI
FT                   DQCRGFVFRNYFPHNSNWHYSLWLGIILIMIGLMGEFYTRRHVSASWYARR"
     gtgtttcgat atcggcagca caaatcccta ttgagcggcg ccatcaccat ggccgagctc        60
     atctttcaca acgtggtgcg cggcgtccgt cagggccatt ccaatgccta tgcggcgttg       120
     ggcaagaaca tgatgcagat cctggtcttt gtgctggtgt tctacatgat gttttcgatg       180
     ctggggctgc gcggttcggc gatccggggc gatttcctgc tctacatcat gtcgggcatt       240
     ttcctgttca tggtgcacat caagacggtg ggtgcggttg ccggggccga agggcccaac       300
     agcgcgatga tgaaacatgc gcccatgaac acgatcattg ccatcctctc ggcggctttg       360
     gggtcgctct atacccagct gctgacgctg ttcctgattc tctttggcta tcatgtcgct       420
     ttcaagccgg tcgagatcgc cgatcctgcc ggtgcgttcg gcatgttgat gctggcctgg       480
     ttcacgggct gtgcggtcgg gttggtgttc ctgtcgatca agccctgggc gccgatgctg       540
     gtgggggtga tgaccacgct ttaccagcgc gccaacatga tcgcctcggg caagatgttc       600
     gttgccaata ccttgccggg ttacatgctg gccatgttcg actggaaccc gctgtttcac       660
     gccatcgacc aatgccgtgg cttcgtgttt cgcaactatt tcccgcataa cagcaactgg       720
     cactattcgc tgtggctggg gatcatcctg atcatgatcg ggctgatggg cgaattctat       780
     acccgccggc atgtctcggc cagctggtac gcgcggcgat ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page