(data stored in ACNUC9435 zone)

EMBL: CP000031.PE390

CP000031.PE390       Location/Qualifiers
FT   CDS_pept        412384..413241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0399"
FT                   /product="tetrapyrrole methylase family protein"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93717"
FT                   /db_xref="GOA:Q5LWE3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWE3"
FT                   /protein_id="AAV93717.1"
FT                   /translation="MNYQKLRLPAGLYFVGTPIGSARDITLRALDVLASAEVIAAEDTR
FT                   SLRHLLDIHGVPLDGRRVLAYHDHSGAGAQARLLEALAEGKSVAYASEAGMPLIADPGF
FT                   ELSRAAAEAGHMVTCAPGPSAVLTALTLAGLPTDAFFFAGFLPNAAAARKTRLETLRGV
FT                   PGTLVFYESPKRLAASLRDMAEVLGGERPAALCRELTKKFEETRRDTLAGLAEALAEAP
FT                   VKGEVVLLVDRARSGPVKDSDIEQDLLAALETHSVRDAADLVARMHDVPRRPVYQLALK
FT                   LGKG"
     ttgaattacc aaaagctcag attgcctgcg ggcctgtatt tcgtcggcac cccgatcggg        60
     tcggcgcgcg acatcacgct cagggcgctg gatgtgctcg cttcggccga ggtgatcgcc       120
     gccgaggata cacgctcgct gcgccatctg cttgatattc acggtgtgcc gctcgatggg       180
     cggcgggtcc ttgcctatca cgatcattcc ggcgccgggg cgcaggcgcg gctgctggag       240
     gcattggccg agggcaagtc ggtggcctat gcctcggagg cggggatgcc attgatcgcc       300
     gatcccggtt tcgaattgag ccgcgccgcc gccgaggcgg gacatatggt gacctgcgca       360
     ccggggccat cggcggtgct gacggcgctg acgcttgcgg gccttccgac ggatgcgttt       420
     ttcttcgcgg ggttcctgcc caacgccgcg gcggcgcgca aaacccgact cgaaactttg       480
     cgcggggtgc ccggcacgct ggtgttttac gaatcgccca aacgcctggc ggccagcctg       540
     cgcgacatgg cagaggtgct tggcggtgag cggccagcgg cactgtgccg tgagttgacc       600
     aagaaattcg aagagacccg ccgcgatacc ttggccggtc tggccgaagc gctggccgag       660
     gcgccggtca agggcgaggt tgtgctgctg gtggatcgcg cccgttcagg cccggttaag       720
     gattccgaca tagaacagga tctgcttgcg gcgcttgaaa cgcattccgt ccgggatgcc       780
     gccgatctgg tggcgcgcat gcatgatgtg ccccggcgcc cggtctacca gttggcgctg       840
     aagctcggga agggatga                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page