(data stored in ACNUC7421 zone)

EMBL: CP000031.PE394

CP000031.PE394       Location/Qualifiers
FT   CDS_pept        complement(416250..417125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0403"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to GB:CAD13614.1"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93721"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWD9"
FT                   /protein_id="AAV93721.2"
FT                   /translation="MTYDLYIGDRSFSSWSLRGWLMLEKFGIPYRSHLVGLYSGTMAAD
FT                   LAPVAPARQVPALRTPDGIALGQSLAMAETLAERHPEAGLWPADPAARATARWLCAEMV
FT                   SSFTALRGECPMQLLHCYEGFQPGAGTLADLARIETLWSHARAVSGAATGPLFGTYSLA
FT                   DVFYVPVAARIIGYGLPVSAAARDYCLFLLGDTAVRQWRAMGLTVRYDPMPYGLDLPVR
FT                   DWPVGTPGAARAVEAGPSVNTACPYSGDPVSDFLELDGRVWGFCNAFCRDKTVADPGAW
FT                   PKFTAMVAKG"
     atgacatatg atctttatat cggcgaccgc agtttctcca gctggtcgct gcgcggttgg        60
     ctgatgcttg agaaattcgg tatcccctat cgctcgcatc tggtggggct ttattccggc       120
     accatggccg ccgatctggc gcccgtggct ccggcacgac aggtgccggc gctgcgcaca       180
     cccgacggca tcgcactggg ccagagcctc gccatggccg agaccctggc cgagcggcat       240
     cccgaggccg ggctgtggcc cgcagatccc gccgcccgcg ccaccgcccg ctggctgtgc       300
     gccgagatgg tgtcgagctt caccgccctg cgcggcgaat gcccgatgca gcttctccat       360
     tgctacgagg ggtttcagcc cggtgcggga acgctggccg atctggcgcg catcgaaacg       420
     ctctggtcgc atgccagggc ggtgtcgggc gccgcgacag ggccgctctt tggtacctat       480
     tcattggcgg atgtgttcta tgtgccggtc gccgcgcgca tcatcggtta tggcctgccg       540
     gttagcgctg cggcgcggga ctattgcctg ttcctgctcg gcgataccgc cgtacggcaa       600
     tggcgggcaa tggggctgac ggtgcgctac gatccgatgc cttatgggct ggacctgccg       660
     gtgcgggatt ggcccgtggg cacccccggc gccgcgcgcg cggtcgaggc cggcccctcg       720
     gtcaacacag cctgccccta ttccggcgat ccggtgagcg atttcctgga actcgatggg       780
     cgcgtctggg ggttctgcaa cgcgttctgc cgtgacaaga cggtggccga tcccggcgca       840
     tggccgaaat tcaccgcgat ggtggccaag ggttaa                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page