(data stored in ACNUC9435 zone)

EMBL: CP000031.PE395

CP000031.PE395       Location/Qualifiers
FT   CDS_pept        complement(417186..417764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0404"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93722"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWD8"
FT                   /protein_id="AAV93722.1"
FT                   /translation="MTRLHLVRHGPTHAKSMVGWSDLPADLSDTGFLTRLAAHLPPQAL
FT                   VVSSDLRRAADTASAIQGDRTRLPHRAALREIHFGAWELRRFAEIEAEDPEHIRAYWET
FT                   PGDVRPPGGESWNEVCARVDAEIDALIAAHPGADLIVVGHFGMILTQVQRALRLEADQA
FT                   FAHRIDNLSVTEITRLPQGWEVGRINHLV"
     gtgacccgcc tacatctggt ccgtcacggc cccacccatg caaaatccat ggtcggctgg        60
     tccgacctgc ccgccgatct gagtgatacc ggctttctga cccgcctcgc ggcgcatctg       120
     ccgccacagg cgctggtcgt ctcgtccgac ctgcgccgcg ccgccgatac cgccagcgcc       180
     atccagggtg accgcacccg cctgccgcac cgggccgcgc tgcgcgagat ccactttggc       240
     gcctgggaac tgcgccgctt tgccgaaatc gaggccgagg atcccgaaca tatccgcgcc       300
     tattgggaaa cccccggcga tgtgcgcccg cctggcggtg aaagctggaa cgaggtctgt       360
     gcccgcgtcg atgccgagat cgacgcgctg atcgccgccc atcccggtgc cgatctgatc       420
     gtggtcggcc atttcggcat gatcctgacc caggtgcagc gcgcgctgcg gctggaagcc       480
     gaccaggcct ttgcccaccg gatcgacaac ctgtcggtga ccgagatcac gcgcctgccg       540
     caggggtggg aggtcgggcg gatcaatcat ctggtgtga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page