(data stored in ACNUC9435 zone)

EMBL: CP000031.PE396

CP000031.PE396       Location/Qualifiers
FT   CDS_pept        complement(417761..418285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0405"
FT                   /product="cobinamide kinase/cobinamide phosphate
FT                   guanyltransferase"
FT                   /note="identified by match to protein family HMM PF02283"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93723"
FT                   /db_xref="GOA:Q5LWD7"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWD7"
FT                   /protein_id="AAV93723.1"
FT                   /translation="MLYPKFTLVLGGAASGKSSFAEQMVVSTGKSRVYFASSQVFDAEM
FT                   QAKIDRHLVQRGPGWTTIEEPLEPGPALSALSARDICLFDCATMWLSNHLLAEGDLDAA
FT                   QERLMAAIRHCPAQLVMVSNEVGHGIVPENALARRFREAQGRLNIALAAEADLVVLVVA
FT                   GLPLALKGQLP"
     atgttgtatc ccaaattcac cttggttctg ggcggtgcgg catcgggcaa gtcgtcattt        60
     gccgaacaga tggttgtttc cactggaaaa tcccgtgttt atttcgccag ttcacaagtt       120
     tttgatgccg agatgcaggc caagatcgac cggcatctgg tccagcgcgg gccgggttgg       180
     accacgatcg aggaaccgct ggagcccggc ccggccctgt ccgcgctgag tgcgcgggat       240
     atctgcctgt ttgactgcgc caccatgtgg ctgagcaatc acttgctggc cgagggcgat       300
     ctggacgccg cgcaggaacg gctgatggcc gcgatccgcc attgcccggc gcagctagtc       360
     atggtctcga acgaggtggg gcacggcatc gtgcccgaaa acgcactggc gcgccggttc       420
     cgcgaggcgc aggggcggct caacatcgcg ctggcggccg aggccgatct ggtcgtgctg       480
     gtggtcgccg ggctgccctt ggcgcttaag gggcagttgc cgtga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page