(data stored in ACNUC9435 zone)

EMBL: CP000031.PE40

CP000031.PE40        Location/Qualifiers
FT   CDS_pept        41301..41885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0041"
FT                   /product="hypothetical protein"
FT                   /note="identified by similarity to PIR:E82361"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93372"
FT                   /db_xref="GOA:Q5LWJ8"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWJ8"
FT                   /protein_id="AAV93372.1"
FT                   /translation="MRWLVALLLVLAAPLAADPVPALFDVTGVAADDVLNVREDPSAGS
FT                   EVIGTLAPDAVGVEVVDLTFGGDWGRVNVNETSGWVSMRYMQQQPESDGVWMTPRFTCS
FT                   GTEPFWSLTVEQGVGARFQIMGEAEQALPAGLLRPGAGLIDRFALPLGHNLAILRQMQC
FT                   HDGMSDRAYGLDVGLMLNGSLYAGCCTLLPN"
     atgaggtggc ttgtcgccct gctgctggtg cttgccgcac cgcttgccgc cgatccggtg        60
     cccgcattgt tcgatgtgac cggggttgcc gccgatgatg tgctgaacgt gcgcgaggac       120
     ccttcggccg ggtccgaagt gatcggcacg ctggcgcccg atgcggtcgg ggtcgaggtt       180
     gtcgacctga cctttggcgg cgactggggc cgggtgaacg tgaacgagac aagcggttgg       240
     gtctcgatgc gctacatgca gcagcagccc gagtccgacg gggtctggat gaccccgcgt       300
     ttcacctgtt ccgggaccga gccgttttgg tcgctgaccg tcgaacaggg ggtcggggcg       360
     cggttccaga tcatgggcga ggcagagcag gctctgccgg ccggtctgct cagacccggg       420
     gcgggtttga tcgaccgctt tgccctgccg ctgggccata acctcgccat cctgcggcag       480
     atgcagtgcc atgacggcat gtccgaccgg gcctatgggc tggatgtggg cctgatgctg       540
     aacggatcgc tttacgccgg ctgctgcacg ctgttgccga actag                       585
//

If you have problems or comments...

PBIL Back to PBIL home page