(data stored in ACNUC9435 zone)

EMBL: CP000031.PE402

CP000031.PE402       Location/Qualifiers
FT   CDS_pept        422854..423549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0411"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93729"
FT                   /db_xref="GOA:Q5LWD1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWD1"
FT                   /protein_id="AAV93729.1"
FT                   /translation="MAKAARFGSAAGPIARFAARGDPARGRRREMSTETFHAELANYLG
FT                   VGDLRSDYPDGGWSWNRHRLTLGRYRVELTQDRQIVAQRPRGGGLIPSTQLAISGVRSF
FT                   AEGERVSDDLCRLLSLAAQSQVVPLSYRFGGRGRQPLHPMGQAIYLRPLLPIRDGAAMR
FT                   TYLETVWPPCYPAQRDRAFRPVPSPYESLRDHHDRRKEILHEYLLRLLDYRGRMLLYRH
FT                   AARVGKDIG"
     atggcgaaag ccgcaagatt cggctcagcc gccgggccga ttgcccgatt tgcggccagg        60
     ggtgacccgg cccgaggtcg ccgacgcgag atgagcacag aaacgtttca cgccgaactg       120
     gccaattatc tcggggtcgg ggacctgcgc agcgactatc ccgatggcgg ctggtcgtgg       180
     aaccgccaca ggctgacact gggccgctac cgggtggagt tgacgcagga ccgccagatc       240
     gtcgcgcagc gcccgcgtgg tggcgggctg atcccgtcca cccaacttgc catttccggt       300
     gtgcgcagct ttgccgaggg cgagcgggtg agcgacgatc tctgccgcct gttgtcattg       360
     gcggcgcagt cgcaggtggt gccgctcagc taccggttcg gcggtcgcgg acgccaaccc       420
     ctgcacccga tggggcaggc aatctattta cgtcctctgt tgcccattcg tgacggcgcc       480
     gcgatgcgga cctatttgga aacggtctgg ccgccttgtt accctgcgca acgagatcgt       540
     gcatttcggc ctgtcccatc gccctacgag tcgctgcgcg accaccacga ccgtagaaag       600
     gaaatcctgc acgaatacct gctgcgcctg ttggactatc gcggtcggat gcttctctat       660
     cgccatgcgg cgcgggtggg caaggatatc ggttga                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page