(data stored in ACNUC7421 zone)

EMBL: CP000031.PE403

CP000031.PE403       Location/Qualifiers
FT   CDS_pept        complement(423669..424136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0412"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93730"
FT                   /db_xref="GOA:Q5LWD0"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWD0"
FT                   /protein_id="AAV93730.1"
FT                   /translation="MTGREEMAKTETTKITPASFTEVLKSMQGPVSMTSLVKPQLEQFW
FT                   DAQEKLLAESERFTRHWFERRHEAIRTALDAARSATAADPANPAQAMETVMDWQRHSVE
FT                   RLVEDAREWFDTVSRCADYVSKTEAEAVGETLNEAQDLARKATKSAKSEPV"
     gtgaccggga gagaagagat ggccaagaca gaaacaacca agatcacccc cgcctcgttc        60
     accgaggtgt tgaaatccat gcaaggaccg gtgtcgatga catcgctggt caagccgcag       120
     ctggaacagt tctgggacgc gcaggagaag ctgctggccg aatccgagcg ctttacccgc       180
     cattggttcg agcgccggca cgaggcgatc cgcaccgcgc tggacgcagc gcgcagcgcc       240
     accgccgctg atccggccaa tccggcccag gcgatggaaa ccgtgatgga ctggcagcgc       300
     cattcggtcg aacggctggt cgaggatgcg cgcgagtggt tcgacaccgt ctcgcgctgt       360
     gccgattacg tgtccaagac cgaggccgag gcggttggcg aaacgctgaa cgaagcccaa       420
     gatctggccc gcaaggcgac caaatcggcg aaatccgagc cggtctga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page